KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr1354Help
Entry
C770_GR4Chr1354   CDS       T02405                                 

Definition
(GenBank) translation elongation factor TU
  KO
K02358  elongation factor Tu
Organism
smeg  Sinorhizobium meliloti GR4
Brite
KEGG Orthology (KO) [BR:smeg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:smeg03012]
    C770_GR4Chr1354
   03029 Mitochondrial biogenesis [BR:smeg03029]
    C770_GR4Chr1354
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smeg04147]
    C770_GR4Chr1354
Translation factors [BR:smeg03012]
 Eukaryotic Type
  Elongation factors
   C770_GR4Chr1354
 Prokaryotic Type
   C770_GR4Chr1354
Mitochondrial biogenesis [BR:smeg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    C770_GR4Chr1354
Exosome [BR:smeg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   C770_GR4Chr1354
  Exosomal proteins of breast cancer cells
   C770_GR4Chr1354
  Exosomal proteins of colorectal cancer cells
   C770_GR4Chr1354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AGA06308
LinkDB All DBs
Position
1427524..1428699
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYEFPGDDIPIVKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEI
EIVGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVDRNGVERGQILCKPGSVKPHR
KFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaaatttgagcgcaataagccgcacgtcaacattggcacgattggccac
gttgaccatggtaagacgtcgctgacggcagcgatcacgaagtatttcggcgagttcaag
gcgtatgaccagatcgacgccgcgccggaagaaaaggcccgcggcatcaccatttcgacg
gcgcacgtcgaatacgagacgccgaaccgtcactatgcgcatgtcgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgcggcgcagatggacggcgcgatcctggtt
gtttcggccgctgacggcccgatgccgcagacgcgcgaacacatcctgctggcccgccag
gtcggcgttccggcgatcgtcgtgttcctgaacaaggtcgaccaggtcgacgacgcggaa
ctgctcgagctcgtcgagctggaagtgcgcgaactgctgtcgtcctacgaattcccgggc
gacgacattccgatcgtcaagggttcggctctggccgcgcttgaagattcggacaagaag
atcggcgaagacgcgatccgcgagctgatggctgcggtcgacgcctacatcccgacgcct
gagcgtccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctcgggc
cgcggtacggtcgtgaccggtcgcgtcgagcgcggcatcgtcaaggtcggtgaggaaatc
gagatcgtcggcatccgtccgacgacgaagacgacctgcacgggcgttgaaatgttccgc
aagctgctcgaccagggccaggccggcgacaacatcggcgcgctgcttcgcggtgtcgac
cgcaacggcgtcgagcgcggtcagattctgtgcaagccgggttcggtcaagccgcaccgc
aagttcaaggctgaagcctacatcctgacgaaggaagagggtggccgtcacacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgacggacgtgaccggcatcgtgacg
cttccggaaggcacggaaatggtcatgccgggcgacaacgtcacggttgacgtcgagctg
atcgtgccgatcgcgatggaagaaaagctgcgcttcgctatccgcgaaggcggccgcacc
gtcggcgcaggcatcgtcgcctccatcgtcgagtaa

DBGET integrated database retrieval system