KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr1862Help
Entry
C770_GR4Chr1862   CDS       T02405                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg00790  Folate biosynthesis
smeg01100  Metabolic pathways
Module
smeg_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:smeg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    C770_GR4Chr1862
Enzymes [BR:smeg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     C770_GR4Chr1862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind BKACE
Motif
Other DBs
NCBI-ProteinID: AGA06793
LinkDB All DBs
Position
complement(1936569..1937420)
Genome map
AA seq 283 aa AA seqDB search
MTYDPFQPSRWHLAHGRDLELGPRGVLMAIINVTPDSFSDGGRFADPDAAVRAALRALEA
GAEILDIGGESTRPDAKPVSADEEQARILPVIAAIARQSQVVISVDTYRAETARLAVDAG
AHIVNDVYGLQREPAIATVAAETGAGLCIMHTGRDREKLSDVIEDQFHFLERSLQIAADA
GVAREGIVLDPGFGFAKDTNENLELMARFRALHEFRRPLLVGTSRKRFVGAVTGREAGGR
DVGTAATTALLRTAGAAIFRVHDVAINRDALAVADAMLAAKNS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgacatacgatccatttcagccttctcgctggcatttggcgcatggacgcgatctcgaa
ctgggcccgcgtggcgttttgatggcgatcatcaatgttacaccggattcattttccgat
ggtgggcgattcgctgatcctgacgctgctgtcagagccgcgctgcgcgcactggaggcg
ggcgcggaaatcctggatattggcggcgaatccacgcgcccggacgccaaaccggtcagc
gccgacgaggaacaggcccgcatcctgcccgttatcgcggcgatcgcgcggcagtcccag
gtcgtcatttcggtcgatacttaccgcgcggaaaccgcccgtttggcggttgacgccggc
gcccacatcgtcaacgacgtgtacgggctccagcgcgagccggcgatcgcgaccgtggcg
gccgaaacgggcgccgggctctgcatcatgcataccgggcgcgaccgggagaaactgagc
gatgtgatcgaggatcagttccatttcctggaacgttccctgcagatcgccgccgacgcc
ggcgtagcgcgggaagggatcgtgctcgatccgggcttcgggttcgcgaaggacacgaac
gagaacctagagctgatggcacgcttccgggcgttgcatgagtttcgacggccgcttctc
gtcggaacgtcgcgcaagcgcttcgtcggcgcggtgaccggccgggaggcgggaggccgc
gacgtcggtaccgccgcgacgacggcgctcctcagaactgccggcgctgctatttttcgg
gtacatgatgtcgcaatcaacagggatgcgttagcggtggccgatgctatgctggccgca
aagaacagctga

DBGET integrated database retrieval system