KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr2456Help
Entry
C770_GR4Chr2456   CDS       T02405                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg00010  Glycolysis / Gluconeogenesis
smeg00620  Pyruvate metabolism
smeg01100  Metabolic pathways
smeg01110  Biosynthesis of secondary metabolites
smeg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smeg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C770_GR4Chr2456
   00620 Pyruvate metabolism
    C770_GR4Chr2456
Enzymes [BR:smeg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     C770_GR4Chr2456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGA07375
LinkDB All DBs
Position
complement(2578039..2579547)
Genome map
AA seq 502 aa AA seqDB search
MLHQKIVENPYKQKYGNFIGGEWREPVAGRYFDNTTPITGGTLCEVARSDAADIEIALDA
AHAAREKWGRTSTTERSNILMKIAARMEDNLELLARAETWDNGKPIRETMAADIPLAIDH
FRYFAACIRAQEGSIGEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALAAGNC
VVLKPAEQTPGSILVWAELIGDLLPPGVLNIVNGFGLEAGKPLATSPRIAKIAFTGETTT
GRLIMQYASQNLIPVTLELGGKSPNIFFADVASEDDDFFDKALEGFAMFALNQGEVCTCP
SRALVQESIYDRFMERAVKRVEAIRQGNPLDEATMIGAQASSEQLEKILAYIEIGKEEGA
EVLTGGGRNVLEGDLSGGYYVKPTVFHGHNRMRIFQEEIFGPVVSVTTFKTEAEALEIAN
DTLYGLGAGVWSRDANRCYRFGRAIEAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMM
LDHYQQTKNMLVSYSPKALGFF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatcagaagatcgtcgagaacccctacaagcagaaatacgggaacttcatcggc
ggcgaatggcgcgaacccgttgcaggccgctatttcgacaacacgacgccgatcaccggc
ggcacgctttgcgaggtcgcgcgttcggacgccgccgacatcgagatcgccctcgacgcg
gcgcacgccgcaagggagaaatggggccggacctcgacgacggagcggtcgaacattctg
atgaagatcgccgcccgcatggaggacaatctggagcttctggcacgggcggaaacctgg
gacaacggcaagccgatccgcgagacgatggccgccgacattccgctggcgatcgatcat
ttccgctatttcgcggcctgcatccgtgcacaggaaggctcgatcggcgagatcgaccac
gacaccgtcgcctaccatttccacgagccgctcggcgtcgtcggccagatcattccctgg
aacttcccgatcctgatggccgcctggaagcttgcgccggcgcttgccgccggaaactgc
gtcgtgctgaagccggccgagcagacgccgggctcgatcctcgtctgggcggaactcatc
ggtgacctcctgccgccgggtgtcctcaacatcgtcaacggcttcggcctcgaagcgggc
aagccgctcgccaccagcccgcgcatcgccaagatcgcttttaccggcgagacgacgacc
gggcggctgatcatgcaatatgccagccagaacctcatcccggtcacgctggagctcggc
ggaaagtcgccgaacatcttcttcgcggacgtcgccagcgaggacgacgacttcttcgac
aaggcgctggaaggcttcgccatgttcgcgctgaaccagggcgaggtctgcacctgcccg
agccgggcactggtacaggagagcatctacgaccgcttcatggagcgggcggtaaagagg
gtcgaggcgatccggcagggcaatccgctcgatgaagcaaccatgatcggcgcccaggct
tcgagcgaacagctcgagaaaatcctcgcctatatcgaaatcggcaaggaggaaggtgcc
gaggtgctgaccggcggcgggcgcaacgtgctcgaaggcgatctttccggcggctactac
gtcaagccgaccgtattccacggccacaacaggatgcgcatctttcaggaggagattttc
gggccggtcgtgtcggtcacgaccttcaagacggaagccgaggcgctggaaatcgccaac
gacacgctctacgggcttggcgccggcgtgtggagccgcgatgccaaccgctgctaccgc
ttcggccgcgcgatcgaagccggccgggtctggaccaattgctaccacgcctatccggcg
cacgccgccttcggcggttacaagcagtccggcatcgggcgcgagacgcacaagatgatg
ctggatcactatcagcagacgaagaacatgctggtcagctacagcccgaaggctctcggc
ttcttctga

DBGET integrated database retrieval system