KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr2500Help
Entry
C770_GR4Chr2500   CDS       T02405                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg00240  Pyrimidine metabolism
smeg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smeg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    C770_GR4Chr2500
Enzymes [BR:smeg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     C770_GR4Chr2500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 KdpD
Motif
Other DBs
NCBI-ProteinID: AGA07419
LinkDB All DBs
Position
complement(2629095..2629682)
Genome map
AA seq 195 aa AA seqDB search
MSKLYFSYATMNAGKSTLLLQAAYNYQERGMRVVMLIAAFDDRAGQGRIASRIGLESEAI
PFRAEDDLHGLIERLNGDGSGEIACVFVDEAQFLGEDQVWQLARVADRLGIPVMAYGLRT
DFQGKLFPGSMALLAIADELREVRTICHCGRKATMVVRLDGRGKVMREGAQVDVGGNEKY
VSYCRRHWDDRMREG
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaactttatttcagctatgcgacgatgaatgccggcaagagcacgctgctcctg
caggccgcctacaactatcaggagcgcggcatgcgcgtcgtgatgctgatagcagccttc
gacgatcgcgccggccagggtcgcatcgcgtctcgcatcgggctggaatcggaggcgatc
cccttccgcgcagaggatgatctccatgggctgatcgagcgcctgaacggcgacggctcc
ggtgaaatcgcctgcgtcttcgtggacgaggcgcagttcctcggtgaagatcaggtctgg
cagttggcgcgtgtggcggatcgcctcggcattccggtcatggcctatggcctgaggacg
gacttccagggcaagctcttccccggctccatggctctgctcgctatcgcggatgagttg
cgcgaagtcaggaccatctgccattgcgggcgcaaggcaacgatggtcgtccgcctcgac
ggccgcggcaaggtcatgcgggagggcgcgcaggtggatgtcggcggcaacgagaaatac
gtctcctattgccgtcgccattgggacgaccggatgcgcgaaggctga

DBGET integrated database retrieval system