KEGG   Sinorhizobium meliloti GR4: C770_GR4pC1168Help
Entry
C770_GR4pC1168    CDS       T02405                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg00010  Glycolysis / Gluconeogenesis
smeg00071  Fatty acid degradation
smeg00350  Tyrosine metabolism
smeg00625  Chloroalkane and chloroalkene degradation
smeg00626  Naphthalene degradation
smeg01100  Metabolic pathways
smeg01110  Biosynthesis of secondary metabolites
smeg01120  Microbial metabolism in diverse environments
smeg01130  Biosynthesis of antibiotics
smeg01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C770_GR4pC1168
  Lipid metabolism
   00071 Fatty acid degradation
    C770_GR4pC1168
  Amino acid metabolism
   00350 Tyrosine metabolism
    C770_GR4pC1168
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C770_GR4pC1168
   00626 Naphthalene degradation
    C770_GR4pC1168
Enzymes [BR:smeg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     C770_GR4pC1168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AGA09856
LinkDB All DBs
Position
pRmeGR4c:complement(1142504..1143532)
Genome map
AA seq 342 aa AA seqDB search
MAQTMKAAVVRQFRAPLTIEEMEVPTPGAGQVLVKYEATGVCHTDLHAANGDWPVKPAPP
FIPGHEGVGFVSAVGAGVRRVKEGDKVGVPWLHTACGYCTYCRTGWETLCASQSNTGYSV
NGTFAEFGLADPEFVGKIPDGLEFGAAAPVLCAGVTVYKGLKETEVRPGEWVAISGVGGL
GHMAVQYAKAMGMHVVAADIFEDKLALAKQLGADIAINGKSEDAIEQVQKATSGGVHGVL
VTAVSPAAMEQAFGFLRSKGTMVLVGLPPGMMSLPVFETVLKRITVRGSIVGTRQDLEES
LVFAAEGKVKPYFSWESLENINDIFHRMEAGKIDGRIVVRLQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcacagacaatgaaggcggctgtcgtacgccagttccgcgctccgctgaccatagag
gagatggaagtcccaacgcctggcgcggggcaggtcctggtaaaatatgaagcgacgggc
gtgtgccataccgatctgcatgcggcaaacggcgattggcccgttaagccggccccgccc
tttattccagggcatgagggtgttggcttcgtctcagccgtgggcgccggcgtgaggaga
gtgaaagaaggtgacaaggttggggtgccatggctccacaccgcttgcggttactgtacc
tattgccggaccggttgggaaacgctgtgcgcttcgcaatcgaacaccgggtactcagtg
aacggcaccttcgcggagttcggactggcagatcccgagttcgtcggaaagattcctgat
gggttggaattcggagccgccgcgcccgttctctgcgcgggagtgaccgtctacaagggg
ctgaaggaaacggaagtccgtcccggtgaatgggtggccatctcgggcgtcgggggtctc
ggccacatggcggtgcaatatgccaaggcaatgggaatgcacgtagtggccgccgacata
ttcgaagacaagctggcgctggctaagcaacttggcgctgacatcgcaataaacggcaag
tcagaagatgcaatcgagcaggtacagaaggccacgagcggcggcgttcacggagtgctc
gtgaccgctgtctctcccgccgccatggaacaggcctttggtttcctgcggtcgaaaggt
acgatggtcttggtcggccttccccccggaatgatgtccttgccggttttcgagaccgtc
ctgaaacgcataaccgtgcgtggatcaatcgtgggcacccgtcaagaccttgaggaatcg
ctcgtgttcgcggcggaaggcaaggtaaagccttatttctcgtgggagagcctcgagaac
atcaacgacatctttcatcgcatggaagcgggcaagatcgacggtcgcatagtcgtgcga
ttgcaatag

DBGET integrated database retrieval system