KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1398Help
Entry
C770_GR4pD1398    CDS       T02405                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg00630  Glyoxylate and dicarboxylate metabolism
smeg00710  Carbon fixation in photosynthetic organisms
smeg01100  Metabolic pathways
smeg01120  Microbial metabolism in diverse environments
smeg01200  Carbon metabolism
Module
smeg_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:smeg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    C770_GR4pD1398
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    C770_GR4pD1398
Enzymes [BR:smeg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     C770_GR4pD1398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AGA11501
LinkDB All DBs
Position
pRmeGR4d:1539756..1540145
Genome map
AA seq 129 aa AA seqDB search
MRITQGCFSFLPDLTDEQITAQVEYCLGKGWAIGVEYTDDPHPRNTYWEMWGNPMFDLKD
AKGVMMELEDCRKAHPQDYIRLNAFDSSRGLETVTMSFIVNRPENEPSLRMTRTESNGRS
QHYMWETQR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcacccagggatgcttctcgttcctgccggacctgaccgacgagcagatcacg
gcgcaggtggaatattgccttggaaagggttgggctatcggcgtcgagtataccgacgac
cctcatcccagaaacacctattgggaaatgtggggcaatccgatgttcgacctcaaggat
gccaaaggcgtgatgatggagctggaggattgccgcaaggcccatccgcaggactatatc
cgcctcaacgccttcgattccagccgcggcctggagacggtgacgatgtcgttcatcgtc
aaccgtcccgaaaacgagccgagcctcaggatgacccggacggagagcaacggccgcagc
cagcactatatgtgggaaacgcagcgatag

DBGET integrated database retrieval system