KEGG   Sinorhizobium meliloti 2011: SM2011_a1386Help
Entry
SM2011_a1386      CDS       T02497                                 

Definition
(GenBank) oxidoreductase
Organism
smel  Sinorhizobium meliloti 2011
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 3HCDH_N FAD_binding_3 NAD_binding_8 Pyr_redox_2 GIDA ApbA UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AGG70449
LinkDB All DBs
Position
pSymA:complement(762533..763702)
Genome map
AA seq 389 aa AA seqDB search
MREQHSSPPVIVIGAGIVGAATASFLALAGTPVRLLDASTPASGATGAADGAVSVASKRP
GPMMTMARAGAALYRELAEEGLFQGLFHRRPTFLVATSDAEADVLSDHSEALAEVGAPVL
WLTRDMAADRLAPLSRKTVAVLEVEDEGHAIGYSIVSRLISAAGLKVERNSPVAALEYDG
RSGRVSGVRVGEAVIEASAVVVAAGGGAGGLIGLPDVSRPRRGQQLVTERAPTLNAALPG
SLLSCSYLLSKKQGGDADQRGYGVVIDPLETGQFLIGSTREEGRNIPENDIDAVAHLAAS
AGDMVPALGRLRILRCFAGIRTAICDGLPMVGRMPGIDNLFVAAGFEGDGICLGPLTGRI
VADLVRGEEPEIDVSPFDPGRFAGRSIAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgagcagcattcttcaccaccagtcattgtgataggcgcgggcattgtcggcgcc
gcgaccgcgtcgtttctcgcgctcgcgggtacgccagttcggctgctcgacgcttcgacg
ccggccagcggggcgaccggcgctgcagatggtgcggtgtcggtggcgagcaagcgcccg
ggtccgatgatgacgatggcccgggccggagcggcgctttatcgcgaactcgcggaggag
gggttgttccaaggcctcttccacaggcggcccaccttcctcgttgcgacgagcgatgcg
gaagccgacgtcctttccgaccactcggaagctctcgccgaggtaggtgcgccggtgctt
tggctcacccgggatatggctgcagaccgattggccccgctctcccgaaagacggtggca
gtgcttgaagtcgaagacgaggggcacgcgatcggctacagcatagtttcgcgcctgatt
tccgccgcagggttgaaggtggagcgcaattcccccgttgcggcgctggaatacgacgga
cgatccggccgcgtcagcggcgttcgtgtcggggaagcggtgatcgaagcctcggcggtg
gtcgtcgccgcaggtggcggcgcgggcgggcttataggacttcccgatgtgtcgcgtcca
cgtagggggcagcaactggtgaccgagcgggcacccaccctgaatgccgccctgccggga
tcgcttctctcctgcagctatctcctcagcaagaagcaagggggcgatgcggatcagcgc
ggatatggcgtcgtcatcgacccgctcgaaaccggccagttcctgatcggctcgacacgg
gaggagggccgcaacatccctgaaaatgatatcgacgcggtggctcacctggcggcctcc
gctggggacatggtgcccgcgctagggcgcttgcgcatccttcggtgcttcgccggaatc
cgcactgcgatatgcgatggcctgccgatggtcggcaggatgcccggtatcgacaatctt
ttcgtcgcagccgggtttgaaggagacggcatctgccttggtccgctgactggccggatt
gtggcggatcttgttcggggggaggagccggagatcgatgtttcgccgttcgatccgggc
cggttcgccggtaggagcatcgcggcatga

DBGET integrated database retrieval system