KEGG   Sinorhizobium meliloti 2011: SM2011_b20198Help
Entry
SM2011_b20198     CDS       T02497                                 

Gene name
cbbL
Definition
(GenBank) Putative ribulose-1,5-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00630  Glyoxylate and dicarboxylate metabolism
smel00710  Carbon fixation in photosynthetic organisms
smel01100  Metabolic pathways
smel01120  Microbial metabolism in diverse environments
smel01200  Carbon metabolism
Module
smel_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:smel00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SM2011_b20198 (cbbL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SM2011_b20198 (cbbL)
Enzymes [BR:smel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SM2011_b20198 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AGG71190
LinkDB All DBs
Position
pSymB:complement(205767..207227)
Genome map
AA seq 486 aa AA seqDB search
MNADAKTEIKGRERYKAGVLKYAQMGYWNGDYEPKDTDLIALFRITPQDGVDPIEAAAAV
AGESSTATWTVVWTDRLTACDQYRAKAYRVDPVPGTPGQYFCYVAYDLILFEEGSIANLT
ASIIGNVFSFKPLKAARLEDMRLPVAYVKTFRGPPTGIVVERERLDKFGKPLLGATTKPK
LGLSGKNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRYLYCMEAVNHASAVTGEVKG
HYLNITAGTMEEMYRRAEFAKELGSVIVMVDLIVGWTAIQSISEWCRQNDMILHMHRAGH
GTYTRQKNHGISFRVIAKWLRLAGVDHLHAGTAVGKLEGDPPTVQGYYNVCREMKNEVDL
PRGLFFEQDWADLKKVMPVASGGIHAGQMHQLLDLFGDDVVLQFGGGTIGHPMGIQAGAT
ANRVALEAMVLARNEGRDIAHEGPEILRAAAKWCKPLEAALDIWGNISFNYTPTDTSDFV
PSVTAA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgacgcaaagacagagatcaagggccgcgaacgttacaaggccggcgtgctg
aaatacgcccagatgggctactggaacggagactacgagccgaaggacaccgacctgatc
gcgctcttccggatcacgccgcaggacggcgtcgatccgatcgaagcggccgccgccgtt
gccggcgaaagctcgacggccacatggacggtcgtctggaccgatcgcctgacggcctgc
gatcaataccgcgccaaggcctaccgggtggatccggtgccgggaacgccggggcagtac
ttctgctatgtcgcctacgacctcatcctcttcgaggaagggtcgatcgcgaacctgacg
gcatcgatcatcggcaacgtcttctcgttcaagccgctgaaggcggcaaggctcgaggat
atgcgcctgcccgtcgcctacgtgaagaccttcaggggtccgccgaccggcatcgtcgtc
gagcgcgaacggctcgacaagttcggcaagccgctgctgggtgccacgaccaagccgaag
ctcggcttgtctggcaagaactatggccgcgtcgtctatgaggggctgaagggcggtctc
gacttcatgaaggacgacgagaacatcaattcgcagcccttcatgcattggcgcgaccgc
tacctctactgcatggaggccgtcaatcacgcttccgccgtcaccggcgaggtgaagggg
cactacctcaacatcactgccggcacgatggaggaaatgtaccggcgcgccgaattcgcc
aaggaactcggctcggtcatcgtcatggtcgatctcatcgtcggttggactgctatccag
tcaatatcggaatggtgccggcagaacgacatgatcctgcacatgcaccgggccggtcac
ggcacctatacgcggcagaagaaccacggcatctccttccgcgtgatcgccaaatggctg
cggctcgccggcgtcgaccacctgcatgcgggcacggccgtaggcaagctcgagggcgac
ccgccgacggtgcagggctactacaatgtctgccgcgaaatgaagaacgaggtcgacctt
ccgcgcggtctgttcttcgagcaggactgggcggacctcaagaaggtcatgcccgtcgcc
tcgggcggcatccatgccggtcagatgcaccagctgctcgatcttttcggcgacgatgtc
gtattgcagttcggcggcggcacgatcgggcatccgatgggcatccaggcaggggccacc
gccaatcgcgtcgccctggaagccatggtgcttgcccgcaacgagggccgcgacatcgcc
cacgaaggtcccgagatcctgcgggcggcggcgaagtggtgcaaaccgctggaagcggcc
ctcgatatctggggcaatatcagcttcaactacaccccgaccgatacgtcggatttcgtg
ccgagcgtaaccgcggcctga

DBGET integrated database retrieval system