KEGG   Sinorhizobium meliloti 2011: SM2011_b20420Help
Entry
SM2011_b20420     CDS       T02497                                 

Definition
(GenBank) Glutathione transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:smel00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SM2011_b20420
Enzymes [BR:smel01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SM2011_b20420
Transporters [BR:smel02000]
 Other Transporters
  Pores ion channels [TC:1]
   SM2011_b20420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3 Tom37 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AGG71406
LinkDB All DBs
Position
pSymB:433993..434619
Genome map
AA seq 208 aa AA seqDB search
MMKLYGLGPTRSLRARWALQELDAEFEFVAVNILAGEAHHPDFLRLNPAGKLPVLVDGDF
VLTESAAIVMYLAEKYGGKGLMPADLKERAQAYRWSLFAVTELEQPLWRMAKHTFLYPEE
KRLPEDIALAKEEFLAMAAVLEQHMKGREFIVGDRISIADCVTAYVLDWGNENGLLDDFP
NLRAYLERMYARPKAPQRIAEAFASLQS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaactatatggattaggtccgacacgctcgcttcgcgcccgttgggcgcttcag
gagctggatgcggaattcgagttcgtggccgtcaacatactggcgggcgaggcccatcac
cccgacttcctgcggctcaatccggcgggcaagcttccggtgctggtcgatggcgacttc
gtcctcacggaatctgcggcgatcgtcatgtatctggcggaaaagtatggcggcaaaggg
cttatgccagcggacctgaaggagcgggcgcaggcgtatcgctggtctctgttcgcggtc
accgaactcgaacagccgctgtggcggatggcaaagcacacgtttctttatcccgaggaa
aagcggttgccggaagacattgcgctcgccaaggaagaattcctggccatggcagcggtg
ctcgaacagcacatgaaagggagggaattcatcgtcggcgacaggataagtatcgccgat
tgcgtaaccgcctatgttctggattggggcaatgaaaacggcctgctcgatgactttcca
aatcttagggcgtatctcgagcggatgtatgcgcgccccaaggcgccgcaacggatcgcg
gaggcatttgcgagccttcagagttag

DBGET integrated database retrieval system