KEGG   Sinorhizobium meliloti 2011: SM2011_c00557Help
Entry
SM2011_c00557     CDS       T02497                                 

Gene name
alr
Definition
(GenBank) Putative alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00473  D-Alanine metabolism
smel01100  Metabolic pathways
smel01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smel00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SM2011_c00557 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SM2011_c00557 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smel01011]
    SM2011_c00557 (alr)
Enzymes [BR:smel01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SM2011_c00557 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:smel01011]
 Precursor biosynthesis
  Racemase
   SM2011_c00557 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGG73706
LinkDB All DBs
Position
complement(1227497..1228636)
Genome map
AA seq 379 aa AA seqDB search
MQSPEFLSASSRLTVDLTALADNWRAMNERSGKARAAAVLKADAYGLGVVHAAPALYAAG
ARDFFVASVEEGADLRPLVPDGRIYILAGMWPGNEELFFENDLVPIINSEEQLAVFMAAL
SERGDHPCVLHVDTGMNRLGLSPEEALALAHDPARPASFSPVLVMSHLACADDPGHPMNR
YQLQRFREVTAAFEGVPASLANSGGVFLGADYHFDLTRPGIAVYGGEAVNGAVNPMKAVV
TAEARIVQVRTVPSGGTASYGASVRFGRDSRIATVAIGYADGYHRSVSGGGVTLRQAMPS
GAFGFLHGMKVPHVGRVTMDLSLFDVTDLPEAAVRAGDYIEVFGRNVVIDDVARAGGTIG
YELLTSLGRRYHRTYVGGA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagccccgagtttctttccgcctccagcaggctcaccgtcgacctcaccgcgctc
gccgacaattggcgggcgatgaacgagcggtccggaaaagcccgcgccgccgccgttctg
aaggccgatgcctacggtctcggcgtcgtgcatgccgctccggctctctatgccgccggc
gcgcgcgatttcttcgtggccagtgtcgaagaaggggccgatcttcgcccgcttgttccg
gatgggcgaatctacattctcgcgggaatgtggcccggcaacgaggagctcttcttcgag
aacgatctcgtgccgatcatcaactcggaagagcagctggcggtcttcatggcagcgctt
tccgaacggggcgaccacccctgcgttctccacgtcgacacgggcatgaaccggctcggc
ctgtcgcctgaggaggcgcttgccctcgcccacgaccctgcgcggcctgcgagtttctcg
ccggtcctcgtcatgagccatctggcctgcgccgacgatcccggacacccgatgaaccgc
tatcagcttcagcgtttccgcgaggtgaccgccgccttcgagggcgtgccggcgagcctt
gcaaattccggcggcgtgttcctcggtgcggactaccacttcgacctcacccggcccggc
atcgcggtctatggcggcgaggcggtaaatggcgcggtcaatccgatgaaagcggtcgtc
accgccgaagcgcgcatcgtgcaggtcaggacggttccatccggcggaacggcaagctac
ggcgcctcggtccgcttcggccgcgacagccgcattgcgacggtcgcgatcggctatgcc
gacggctaccaccgttcggtttcgggcggcggcgtcaccctcagacaggcgatgccctcg
ggcgccttcggtttcctgcatggtatgaaggtgccgcatgtcggtcgggtgacgatggat
ctgagcctgttcgatgtcacggacctgccggaagcggccgtacgtgccggcgattatatc
gaggtcttcgggcgcaatgtcgtcatcgacgacgtcgcgcgcgccggcggtaccatcggc
tacgagctgctgacgagcctcggccggcgctatcatcggacctatgtcggaggcgcttga

DBGET integrated database retrieval system