KEGG   Sinorhizobium meliloti 2011: SM2011_c01311Help
Entry
SM2011_c01311     CDS       T02497                                 

Gene name
tufA
Definition
(GenBank) putative elongation factor TU protein
  KO
K02358  elongation factor Tu
Organism
smel  Sinorhizobium meliloti 2011
Brite
KEGG Orthology (KO) [BR:smel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:smel03012]
    SM2011_c01311 (tufA)
   03029 Mitochondrial biogenesis [BR:smel03029]
    SM2011_c01311 (tufA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smel04147]
    SM2011_c01311 (tufA)
Translation factors [BR:smel03012]
 Eukaryotic Type
  Elongation factors
   SM2011_c01311 (tufA)
 Prokaryotic Type
   SM2011_c01311 (tufA)
Mitochondrial biogenesis [BR:smel03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SM2011_c01311 (tufA)
Exosome [BR:smel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SM2011_c01311 (tufA)
  Exosomal proteins of breast cancer cells
   SM2011_c01311 (tufA)
  Exosomal proteins of colorectal cancer cells
   SM2011_c01311 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AGG73933
LinkDB All DBs
Position
1477277..1478452
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYEFPGDDIPIVKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEI
EIVGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVDRNGVERGQILCKPGSVKPHR
KFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaaatttgagcgcaataagccgcacgtcaacattggcacgattggccac
gttgaccatggcaagacgtcgctgacggcagcgatcacgaagtatttcggcgagttcaag
gcgtatgaccagatcgacgccgcgccggaagaaaaggcccgcggcatcaccatttcgacg
gcgcacgtcgaatacgagacgccgaaccgtcactatgcgcatgtcgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgcggcgcagatggacggcgcgatcctggtt
gtttcggccgctgacggcccgatgccgcagacgcgcgaacacatcctgctggcccgccag
gtcggcgttccggcgatcgtcgtgttcctgaacaaggtcgaccaggtcgacgacgcggaa
ctgctcgagctcgtcgagctggaagtgcgcgaactgctgtcgtcctacgaattcccgggc
gacgacattccgatcgtcaagggttcggctctggccgcgcttgaagattcggacaagaag
atcggcgaagacgcgatccgcgagctgatggctgcggtcgacgcctacatcccgacgcct
gagcgtccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctcgggc
cgcggtacggtcgtgaccggtcgcgtcgagcgcggcatcgtcaaggtcggtgaggaaatc
gagatcgtcggcatccgtccgacgacgaagacgacctgcacgggcgttgaaatgttccgc
aagctgctcgaccagggccaggccggcgacaacatcggcgcgctgcttcgcggtgtcgac
cgcaacggcgtcgagcgcggtcagattctgtgcaagccgggttcggtcaagccgcaccgc
aagttcaaggctgaagcctacatcctgacgaaggaagagggtggccgtcacacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgacggacgtgaccggcatcgtgacg
cttccggaaggcacggaaatggtcatgccgggcgacaacgtcacggttgacgtcgagctg
atcgtgccgatcgcgatggaagaaaagctgcgcttcgctatccgcgaaggcggccgcacc
gtcggcgcaggcatcgtcgcctccatcgtcgagtaa

DBGET integrated database retrieval system