KEGG   Sinorhizobium meliloti 2011: SM2011_c01578Help
Entry
SM2011_c01578     CDS       T02497                                 

Gene name
aatA
Definition
(GenBank) Aspartate aminotransferase A (transaminase)
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00220  Arginine biosynthesis
smel00250  Alanine, aspartate and glutamate metabolism
smel00270  Cysteine and methionine metabolism
smel00330  Arginine and proline metabolism
smel00350  Tyrosine metabolism
smel00360  Phenylalanine metabolism
smel00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smel00401  Novobiocin biosynthesis
smel01100  Metabolic pathways
smel01110  Biosynthesis of secondary metabolites
smel01130  Biosynthesis of antibiotics
smel01210  2-Oxocarboxylic acid metabolism
smel01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SM2011_c01578 (aatA)
   00270 Cysteine and methionine metabolism
    SM2011_c01578 (aatA)
   00220 Arginine biosynthesis
    SM2011_c01578 (aatA)
   00330 Arginine and proline metabolism
    SM2011_c01578 (aatA)
   00350 Tyrosine metabolism
    SM2011_c01578 (aatA)
   00360 Phenylalanine metabolism
    SM2011_c01578 (aatA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SM2011_c01578 (aatA)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SM2011_c01578 (aatA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smel01007]
    SM2011_c01578 (aatA)
Enzymes [BR:smel01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     SM2011_c01578 (aatA)
Amino acid related enzymes [BR:smel01007]
 Aminotransferase (transaminase)
  Class I
   SM2011_c01578 (aatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_MocR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGG74917
LinkDB All DBs
Structure
PDB: 

Position
complement(2515418..2516620)
Genome map
AA seq 400 aa AA seqDB search
MAFLADALSRVKPSATIAVSQKARELKAKGRDVIGLGAGEPDFDTPDNIKKAAIDAIDRG
ETKYTPVSGIPELREAIAKKFKRENNLDYTAAQTIVGTGGKQILFNAFMATLNPGDEVVI
PAPYWVSYPEMVALCGGTPVFVPTRQENNFKLKAEDLDRAITPKTKWFVFNSPSNPSGAA
YSHEELKALTDVLMKHPHVWVLTDDMYEHLTYGDFRFATPVEVEPGLYERTLTMNGVSKA
YAMTGWRIGYAAGPLHLIKAMDMIQGQQTSGAASIAQWAAVEALNGPQDFIGRNKEIFQG
RRDLVVSMLNQAKGISCPTPEGAFYVYPSCAGLIGKTAPSGKVIETDEDFVSELLETEGV
AVVHGSAFGLGPNFRISYATSEALLEEACRRIQRFCAACR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggccttccttgccgatgccctttcccgtgtaaagccttccgccaccatcgctgtttcg
cagaaagcccgcgagttgaaagcgaaaggccgcgatgtcatcggcctcggcgcaggggag
ccggacttcgacacgcctgacaacatcaagaaggccgcgatcgacgcgatcgatcgcggc
gagacgaagtacacgccggtctccggcattccggaactgcgcgaagccatcgcgaagaaa
ttcaagcgcgagaacaatctcgactacaccgcggcgcagacgatcgtcggcaccggcgga
aagcagattctcttcaacgccttcatggcgacgctcaacccgggcgacgaagtggtgatt
ccggcaccgtactgggtctcctatccggaaatggtggcgctgtgcggcggcacacccgtc
ttcgtcccgaccaggcaggaaaacaatttcaagctcaaggccgaggatctcgaccgcgcg
atcacgccgaagaccaagtggttcgtcttcaactcgccgtccaacccctcgggtgcggcc
tattcgcatgaggagctcaaggcgctcacggacgttctcatgaagcatccgcatgtctgg
gtcctgacggacgacatgtacgagcacctgacctatggcgacttcaggttcgcgaccccg
gtcgaagtggagcccggcctctacgagcgcacgctgacgatgaacggcgtctccaaggcc
tatgcgatgaccggctggcgcatcggctacgcggccgggccgcttcatctcatcaaggcg
atggacatgatccagggccagcagacttcgggcgccgcctcgatcgcgcagtgggcggcc
gtcgaggcgctcaacggtccgcaggacttcatcgggcgcaacaaggagatcttccagggc
cgccgcgatctcgtcgtctcgatgctgaaccaggccaagggcatttcctgcccgacgccg
gagggcgccttctacgtctatccgtcctgcgccggcctgatcggcaagaccgcgccttcg
ggcaaggtgatcgaaacggatgaggatttcgtctccgagcttttggagaccgaaggcgtg
gctgtggtccacggctcggccttcggcctcggcccgaacttccgcatctcctacgcgact
tccgaggcgctgctggaggaggcttgccgccgcatccagcgcttctgcgccgcctgcaga
taa

DBGET integrated database retrieval system