KEGG   Sinorhizobium meliloti 2011: SM2011_c02092Help
Entry
SM2011_c02092     CDS       T02497                                 

Gene name
fabZ
Definition
(GenBank) putative 3R-hydroxymyristoyl-acyl carrier protein dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00061  Fatty acid biosynthesis
smel00780  Biotin metabolism
smel01100  Metabolic pathways
smel01212  Fatty acid metabolism
Module
smel_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:smel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SM2011_c02092 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SM2011_c02092 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:smel01004]
    SM2011_c02092 (fabZ)
Enzymes [BR:smel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     SM2011_c02092 (fabZ)
Lipid biosynthesis proteins [BR:smel01004]
 Fatty acid synthase
  Component type
   SM2011_c02092 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AGG74083
LinkDB All DBs
Position
1617769..1618233
Genome map
AA seq 154 aa AA seqDB search
MNEAATVLGTADIQEILRLLPHRYPFLLVDRIIEIDDDNSAIGIKNVTANEPHFTGHFPE
KPIMPGVLLIEGMAQTAGAICARKTGIGSNLVYFMTIDNARFRKPVVPGDRVEFHVVKQK
QRGNIWKFHCDAKVDGQLVAEADIGAMIVSKEDA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaggctgcaacggtcctcggcacggcggacatacaggaaatcctgaggcttctt
ccccatcgttaccccttcctgctggtggaccgcatcatcgagatcgatgacgacaattcg
gccatcgggatcaagaacgtgacggccaacgagccgcatttcaccgggcactttcccgag
aagccgatcatgccgggcgttcttctgatcgaaggcatggcgcagacggccggcgcgatc
tgtgcgcgcaagacgggaatcggaagcaatctcgtctatttcatgacgatcgacaatgca
cggttccgcaaacccgtcgtgccgggcgaccgggtggagttccatgtcgtgaagcagaag
cagcgcggcaatatctggaaatttcactgcgatgcaaaagttgacgggcaactcgtcgcg
gaagctgatatcggcgcgatgattgtcagcaaggaagacgcctga

DBGET integrated database retrieval system