KEGG   Sinorhizobium meliloti 2011: SM2011_c02520Help
Entry
SM2011_c02520     CDS       T02497                                 

Gene name
glpD
Definition
(GenBank) Putative glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00564  Glycerophospholipid metabolism
smel01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smel00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SM2011_c02520 (glpD)
Enzymes [BR:smel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SM2011_c02520 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 Pyr_redox_2 FAD_binding_3 NAD_binding_8 K_oxygenase GIDA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AGG75602
LinkDB All DBs
Position
3270845..3272356
Genome map
AA seq 503 aa AA seqDB search
MSEQTIFDVFVIGGGINGCGIARDAAGRGYSVALAEMSDFASGTSSGSTKLIHGGLRYLE
HYEFRLVREALMEREVLWAMAPHVIWPMRFVLPFHKGGPRPAWLIRLGLFLYDHIGGRKL
LPATKTLDMTRDPAGAPLKGLFTKAFEYSDGWVDDARLVVLNARDAADRGARIMARTRVV
SARREGGRWAIEIESTETGARETMRARMLVNAAGPWVDRVLSEAVGNNDVRNVRLVQGSH
IVVKKKFDDPRAYFFQNPDGRIMFAIPYQDEFTLIGTTDRDFTGNPADVRISDAEIDYLC
RAASEYFSDPVGREDIVWTYSAVRPLFDDGASKAQEATRDYVLRVENGDAPLLNVFGGKL
TTYRRLAESALEKIGETIGEKGRKWTAVSHLPGGDFPAAGYDDEVAKLRTRYPFLTASHA
RRLVRLYGTRAAQLLGNAASEADLGKHFGADLYAAEVDWLIVQEWALRAEDVLWRRTKLG
LKFSRAQTAELEEYMRGAVNAAA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagagcagacgatcttcgacgtcttcgtcataggcggcggcatcaacggatgcggc
atcgcgcgtgatgcggctggccgcggatattccgtcgcgctggcggagatgagcgatttc
gcctccggaacatcctccggctcgaccaagctcatccatggcggcttgcgctatctcgaa
cattatgaattccgcctcgtgcgcgaagccctgatggagcgcgaagtcctctgggcgatg
gcgccgcacgtgatctggccgatgcgcttcgtgctgcccttccacaagggtggtccgcgg
ccggcatggctgatccgcctcggcctcttcctttacgatcatataggcggccgtaagctt
ctgccggcgacgaagacgctcgacatgacgcgcgatcccgcgggcgcaccgctgaagggc
ctcttcaccaaagcattcgaatattcggacggctgggtcgacgatgctcgcctcgtggtg
ctgaacgcgcgcgacgccgccgaccgcggcgcgaggatcatggcacgcacccgcgtcgtc
tcggcgcgccgcgagggcggccgttgggcaatcgaaatcgagagcacggagacgggcgcg
cgcgagacgatgcgcgcccgcatgctcgtcaatgccgcgggcccctgggtggaccgggtt
ctctccgaagcggtcggcaacaacgacgtccgcaatgtccgcctggtccagggcagccat
atcgtcgtgaagaagaagttcgacgatccgcgcgcctatttcttccagaacccggacggg
cggatcatgttcgccattccttaccaggacgagttcacgctgatcggaaccaccgatcgc
gatttcaccggcaatccggctgacgtgcgcatcagcgatgcggagatagattatctctgc
agggcggcgagcgaatatttcagcgacccggtcggcagagaggatatcgtgtggacctat
tccgccgtgcgcccccttttcgatgacggtgcgagcaaggcgcaggaggcgacccgcgac
tatgtgctgcgcgtcgagaacggcgatgcaccgctgctcaacgtcttcggcggcaagctc
accacctacaggcggcttgcggaatcggcgctcgagaagatcggcgagaccatcggggaa
aagggcaggaaatggacggccgtatcgcatctgccgggcggcgattttccggccgccggc
tatgacgacgaggtcgcgaagctcaggacgcgctatcctttcctgaccgcttcccacgcc
cgccggctggtacggctctacggcacgcgggcggcgcagcttctcggcaatgccgcgagc
gaggccgacctcggaaagcacttcggcgcggatctctatgctgcggaagtggattggctc
atcgtgcaggaatgggcattgcgcgcggaggacgtgctttggcgccgcacgaaactggga
ctgaagttttcgcgggcgcaaaccgcggaactggaggaatatatgcggggcgcggtcaac
gcggccgcctga

DBGET integrated database retrieval system