KEGG   Sinorhizobium meliloti 2011: SM2011_c02736Help
Entry
SM2011_c02736     CDS       T02497                                 

Gene name
tdk
Definition
(GenBank) putative thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00240  Pyrimidine metabolism
smel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smel00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SM2011_c02736 (tdk)
Enzymes [BR:smel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SM2011_c02736 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 KdpD
Motif
Other DBs
NCBI-ProteinID: AGG74990
LinkDB All DBs
Position
complement(2589843..2590430)
Genome map
AA seq 195 aa AA seqDB search
MSKLYFSYATMNAGKSTLLLQAAYNYQERGMRVVMLIAAFDDRAGQGRIASRIGLESEAI
PFRAEDDLHGLIERLNGDGSGEIACVFVDEAQFLGEDQVWQLARVADRLGIPVMAYGLRT
DFQGKLFPGSMALLAIADELREVRTICHCGRKATMVVRLDGRGKVMREGAQVDVGGNEKY
VSYCRRHWDDRMREG
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaactttatttcagctatgcgacgatgaatgccggcaagagcacgctgctcctg
caggccgcctacaactatcaggagcgcggcatgcgcgtcgtgatgctgatagcagccttc
gacgatcgcgccggccagggtcgcatcgcgtctcgcatcgggctggaatcggaggcgatc
cccttccgcgcagaggatgatctccatgggctgatcgagcgcctgaacggcgacggctcc
ggtgaaatcgcctgcgtcttcgtggacgaggcgcagttcctcggtgaagatcaggtctgg
cagttggcgcgtgtggcggatcgcctcggcattccggtcatggcctatggcctgaggacg
gacttccagggcaagctcttccccggctccatggctctgctcgctatcgcggatgagttg
cgcgaagtcaggaccatctgccattgcgggcgcaaggcaacgatggtcgtccgcctcgac
ggccgcggcaaggtcatgcgggagggcgcgcaggtggatgtcggcggcaacgagaaatac
gtctcctattgccgtcgccattgggacgaccggatgcgcgaaggctga

DBGET integrated database retrieval system