KEGG   Sinorhizobium meliloti RMO17: DU99_01640Help
Entry
DU99_01640        CDS       T03395                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
smer  Sinorhizobium meliloti RMO17
Pathway
smer00480  Glutathione metabolism
smer01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smer00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DU99_01640
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smer02000]
    DU99_01640
Enzymes [BR:smer01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DU99_01640
Transporters [BR:smer02000]
 Other Transporters
  Pores ion channels [TC:1]
   DU99_01640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin GST_N_4 GST_C_5 Tom37
Motif
Other DBs
NCBI-ProteinID: AIL98156
UniProt: A0A222I5F8
LinkDB All DBs
Position
complement(351195..351881)
Genome map
AA seq 228 aa AA seqDB search
MTAQLTLISHHLCPYVQRAAIALHEKGVPFERVDIDLANKPDWFLKISPLGKVPLLRISQ
DGGEAILFESTVICEYLEETQAGPKLHPADPLARARHRGWMEFGSAILSDLWVYETTQDG
ATLEAKRNVLKSKFATVEAELGSGPYFAGSAFSLVDAVFAPIFRYFDVFDTISDSGVFQG
LPRVTAWREALAGRPSVKAAVGEDYPQRLMAFLEKHEAALLKTERVAA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgcagctcaccctgatcagccaccatctctgcccctatgtgcaacgcgctgcg
attgcgctgcacgaaaaaggcgtacccttcgagcgcgtcgatatcgatctcgccaacaag
cccgactggttcctgaagatctcgccgctcggcaaggtgccgctgcttcgcatttcacag
gatggcggcgaagcgatcctcttcgagagcaccgtcatctgcgaatatctggaggaaaca
caggccggaccgaagctgcaccccgccgatccgctggcgcgggcacgccatcgcggctgg
atggagttcggctctgcaatcctctccgacctctgggtctacgaaacaacgcaggacggc
gccacgctcgaagccaaacgcaacgtgctcaagtcgaagttcgcgaccgtcgaggcggaa
ctcggcagcggcccctattttgcaggcagcgccttcagccttgtcgacgccgtcttcgcg
ccgatcttccgctatttcgacgtgttcgacacgatttccgacagcggcgtctttcagggc
ctgccgcgcgtcaccgcctggcgcgaggcgctggccgggaggccgagcgtgaaagccgcg
gtcggcgaggactacccgcagcggctgatggccttcctcgagaagcacgaggcagcgctg
ctcaagacggaaagggtggctgcctga

DBGET integrated database retrieval system