KEGG   Sinorhizobium meliloti RMO17: DU99_07895Help
Entry
DU99_07895        CDS       T03395                                 

Definition
(GenBank) hypothetical protein
  KO
K09949  uncharacterized protein
Organism
smer  Sinorhizobium meliloti RMO17
Brite
KEGG Orthology (KO) [BR:smer00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    DU99_07895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxI_C LpxI_N DUF1263 PucR
Motif
Other DBs
NCBI-ProteinID: AIL99331
UniProt: A0A220MX69
LinkDB All DBs
Position
1608059..1608946
Genome map
AA seq 295 aa AA seqDB search
MAVAIHRLPQSKGRLAIIAGAGTLPHHVAEAARLQGEDPFIIALSREADTDWTGFDHAVC
AIGDFAAISRTFETEGIDRVVLSGAVRRRPEWRDIRPTLKTLAKVPRVFRTLISGGDDAV
LRMVIELIEASGAHVIGAHEVVPGLLADTGRLGAHAPTDEDRRDIEAGIAAANALGALDV
GQGAVAVGGRVVALEGAEGTDAMLARVADLRKDGRISIRRRGVLVKLCKPQQDERADLPS
IGPSTVAGAHAAGLAGIAVEAGRALVLERARLVEEADRSGLFILGIERDGRRDRR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggcgattcatcgcctgccgcagtcaaaaggcaggctcgccatcatcgccggc
gccggaacgcttccccatcacgtggccgaggccgcacgccttcagggtgaagacccgttc
atcattgcgctttcgcgtgaggccgatacggattggaccggcttcgaccatgccgtttgt
gcaatcggagactttgccgcgatcagccgcactttcgagaccgagggaatcgaccgggtc
gtcctttccggtgcggtgcggcgacggccggagtggcgcgatatccgtcctacgctgaag
acgctggccaaggtgccgcgggttttccgcaccttgatatccggcggggacgacgccgtg
ctgcgcatggtgatcgaattgatcgaggcaagtggcgcccatgtgatcggcgcgcacgag
gtcgttccggggcttcttgccgataccggtcggctcggcgcccatgccccgacggacgaa
gaccggcgtgacatcgaagccggcatcgccgcagccaacgcgctgggggcgctggatgtg
ggccagggcgccgttgcagtcggcggcagggtggtggcgctggagggggcggaagggacg
gacgccatgttggcgagagtggccgacctcaggaaagacgggcggatttcaatccgtcgt
cgcggcgttctcgtcaagctctgcaagccgcaacaggacgagcgggcggacctgccctcg
atcggtccgtcgacggtcgcaggagcgcatgcagccggcctcgcgggcatcgccgtcgag
gcgggacgcgcgctggttctcgagcgcgcgcgtctcgtggaggaggccgacaggagcggg
ctgttcattctcggtatcgagcgcgacggccgcagggaccggagatga

DBGET integrated database retrieval system