KEGG   Sinorhizobium meliloti RMO17: DU99_09855Help
Entry
DU99_09855        CDS       T03395                                 

Definition
(GenBank) histidine kinase
Organism
smer  Sinorhizobium meliloti RMO17
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliO
Motif
Other DBs
NCBI-ProteinID: AIL99674
UniProt: A0A222I0Z4
LinkDB All DBs
Position
1989402..1990367
Genome map
AA seq 321 aa AA seqDB search
MMETILGDNASRFMIAAGAVAIGLLCLVAVLRLMRNKPSSPFVRGGKNRQPRLAVLDAAA
VDTRRRLVLVRRDDVEHLIMIGGPTDIVIESRIAPEGESPVPATLQAEPEEKTTRAPIAE
VRPRPVPSPVPPEPPLPTEAAAEPVRQPARPSEPPRVAARPEPPVRVVPDQQQAPALGSS
QPQQVSRPLPAPHIPPVSAIEPSHTDFGAVRDRPLPVEPAARDERPVPLTAIEPVKGMPG
QSLPPRPAAPEAAAEFERMLDAEISGDLQRFTPSGPPRPEIRPAGRQEPVLGSPSQDTRK
EPTIEEEMERMLADISVSRKL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaacaatcctcggggacaacgccagccggttcatgatcgccgccggagcggtt
gcgatcggtctcttgtgcctcgtggccgtgcttcggctcatgcgcaacaagccctcctct
cccttcgtccgcggcggcaagaacaggcagccgcggcttgcggtgctcgatgccgccgca
gtcgacacgcgtcggcgcctggtgctcgtccgccgcgacgacgtcgaacacctgatcatg
atcggcggcccgacggacatcgtgatcgaaagccgcatcgcccccgagggagaaagcccg
gttccggccacgcttcaggcggagccggaagaaaagacgacccgcgccccgattgcggaa
gtccggccccggccggttccttcccctgtcccgcccgagccccctctcccgacggaagct
gcggccgaacccgtgcggcaaccggcgcgcccgagtgagccgccgcgggtcgccgcgcgc
ccggagcctccagtgcgcgtggtcccggatcagcagcaggcccccgcactcggctcgtcg
cagccgcagcaggtctccaggcctttacctgcgcctcacattccgccggtatccgccatc
gagccgtcgcataccgatttcggcgcggtgcgtgaccgcccgcttccggtggagcccgcg
gctcgcgacgagcgccccgtcccgcttacggcgatcgaaccggtaaagggcatgccgggc
caatctctcccgcctcggcccgccgcgccggaagcagccgcagaattcgagcgcatgctc
gatgcggaaatcagcggcgatctccagcgcttcacaccttcggggccgccgcgtccggag
atcaggcccgccggtcgccaggaaccggtactcggatcgccctcgcaggacacccgcaag
gagccgacgatcgaagaggagatggaaaggatgctcgccgatatctccgtgagccgcaaa
ttgtaa

DBGET integrated database retrieval system