KEGG   Sinorhizobium meliloti RMO17: DU99_12195Help
Entry
DU99_12195        CDS       T03395                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
smer  Sinorhizobium meliloti RMO17
Pathway
smer00473  D-Alanine metabolism
smer00550  Peptidoglycan biosynthesis
smer01100  Metabolic pathways
smer01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smer00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DU99_12195
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DU99_12195
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DU99_12195
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smer01011]
    DU99_12195
Enzymes [BR:smer01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DU99_12195
Peptidoglycan biosynthesis and degradation proteins [BR:smer01011]
 Precursor biosynthesis
  Amino acid ligase
   DU99_12195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 GARS_A CPSase_L_D2 ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AIM00120
UniProt: A0A222HGS1
LinkDB All DBs
Position
complement(2424683..2425609)
Genome map
AA seq 308 aa AA seqDB search
MSSKHVAVLLGGFSSERPVSLSSGTACADALEAEGYRVTRVDVGRDVAAVLQELRPDVVF
NALHGPFGEDGTIQGILEYLEIPYTHSGVLASALAMDKDQAKHVAKAAGIPVAEALVMDR
RSFGNQHPMKPPYVVKPVREGSSFGVVIVKEDQSHPPQVITSSEWRYGDRVMVERYIAGR
EFTCGVMGDVALGVTEIIPQGHAFYDYDSKYVKGGSKHVIPAQISPNIYQKIQTLALKAH
QAIGCRGVSRSDFRFDDRGDGEGELIWLEINTQPGMTPTSLVPEMAQHAGLQFGEFLRWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaagcatgttgctgtcctgttgggcggattttcctcggagaggccggtgagc
ctgtcttcggggactgcttgcgcggatgccctggaggccgaaggctatcgcgtcacgcgc
gtcgatgtcggtcgcgacgtcgcggcggttcttcaggaattgcgtccggatgtcgtcttc
aacgcgcttcatgggccgttcggcgaggacgggacgatccagggcattctcgaatatctc
gagattccctatacccattcgggcgttttggcctcggcgctggccatggataaagatcag
gcaaagcatgtcgccaaggctgccggcattccggttgccgaagccttggtcatggaccgg
cgcagcttcggcaatcagcacccgatgaagccgccttacgtggtgaagccggtccgcgag
gggtcgagcttcggagtggtgatcgtcaaggaggatcagtcgcatccgcctcaggtgatc
acctcgagcgagtggcgctacggcgaccgcgtcatggtcgagcgctatattgcggggcgc
gaattcacctgcggtgtcatgggcgacgtcgccctcggcgtcactgaaatcattccgcag
gggcacgccttctacgattacgactcgaaatacgtaaaaggtggttcgaagcacgtcata
cctgcacagatttcaccaaatatttaccaaaaaatacaaacactggcgttgaaggcgcat
caggcgatcggttgccgcggcgtcagccggtccgactttcgtttcgacgatcgtggggat
ggtgagggcgagttgatctggctcgagatcaacacccaacccggcatgaccccaacatcc
ctggtgcccgaaatggcgcagcatgctggccttcagttcggtgaatttctcaggtggatg
gtggaggacgcgtcgtgcttgcgctga

DBGET integrated database retrieval system