KEGG   Sinorhizobium meliloti RMO17: DU99_13135Help
Entry
DU99_13135        CDS       T03395                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
smer  Sinorhizobium meliloti RMO17
Pathway
smer00010  Glycolysis / Gluconeogenesis
smer00620  Pyruvate metabolism
smer01100  Metabolic pathways
smer01110  Biosynthesis of secondary metabolites
smer01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DU99_13135
   00620 Pyruvate metabolism
    DU99_13135
Enzymes [BR:smer01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     DU99_13135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIM00301
UniProt: A0A220MZ76
LinkDB All DBs
Position
complement(2624090..2625598)
Genome map
AA seq 502 aa AA seqDB search
MLHQKIVENPYKQKYGNFIGGEWREPVAGRYFDNTTPITGGTLCEVARSDAADIEIALDA
AHAAREKWGRTSTTERSNILMKIAARMEDNLELLARAETWDNGKPIRETMAADIPLAIDH
FRYFAACIRAQEGSIGEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALAAGNC
VVLKPAEQTPGSILVWAELIGDLLPPGVLNIVNGFGLEAGKPLATSPRIAKIAFTGETTT
GRLIMQYASQNLIPVTLELGGKSPNIFFADVASEDDDFFDKALEGFAMFALNQGEVCTCP
SRALVQESIYDRFMERAVKRVEAIRQGNPLDEATMIGAQASSEQLEKILAYIEIGKEEGA
EVLTGGGRNVLEGDLSGGYYVKPTVFHGHNRMRIFQEEIFGPVVSVTTFKTEAEALEIAN
DTLYGLGAGVWSRDANRCYRFGRAIEAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMM
LDHYQQTKNMLVSYSPKALGFF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatcagaagatcgtcgagaacccctacaagcagaaatacgggaacttcatcggc
ggcgaatggcgcgaacccgttgcaggccgctatttcgacaacacgacgccgatcaccggc
ggcacgctttgcgaggtcgcgcgttcggacgccgccgacatcgagatcgccctcgacgcg
gcgcacgccgcaagggagaaatggggccggacctcgacgacggagcggtcgaacattctg
atgaagatcgccgcccgcatggaggacaatctggagcttctggcacgggcggaaacctgg
gacaacggcaagccgatccgcgagacgatggccgccgacattccgctggcgatcgatcat
ttccgctatttcgcggcctgcatccgtgcacaggaaggctcgatcggcgagatcgaccac
gacaccgtcgcctaccatttccacgagccgctcggcgtcgtcggccagatcattccctgg
aacttcccgatcctgatggccgcctggaagcttgcgccggcgcttgccgccggaaactgc
gtcgtgctgaagccggccgagcagacgccgggctcgatcctcgtctgggcggaactcatc
ggtgacctcctgccgccgggtgtcctcaacatcgtcaacggcttcggcctcgaagcgggc
aagccgctcgccaccagcccgcgcatcgccaagatcgcttttaccggcgagacgacgacc
gggcggctgatcatgcaatatgccagccagaacctcatcccggtcacgctggagctcggc
ggaaagtcgccgaacatcttcttcgcggacgtcgccagcgaggacgacgacttcttcgac
aaggcgctggaaggcttcgccatgttcgcgctgaaccagggcgaggtctgcacctgcccg
agccgggcactggtacaggagagcatctacgaccgcttcatggagcgggcggtaaagagg
gtcgaggcgatccggcagggcaatccgctcgatgaagcaaccatgatcggcgcccaggct
tcgagcgaacagctcgagaaaatcctcgcctatatcgaaatcggcaaggaggaaggtgcc
gaggtgctgaccggcggcgggcgcaacgtgctcgaaggcgatctttccggcggctactac
gtcaagccgaccgtattccacggccacaacaggatgcgcatctttcaggaggagattttc
gggccggtcgtgtcggtcacgaccttcaagacggaagccgaggcgctggaaatcgccaac
gacacgctctacgggcttggcgccggcgtgtggagccgcgatgccaaccgctgctaccgc
ttcggccgcgcgatcgaagccggccgggtctggaccaattgctaccacgcctatccggcg
cacgccgccttcggcggttacaagcagtccggcatcgggcgcgagacgcacaagatgatg
ctggatcactatcagcagacgaagaacatgctggtcagctacagcccgaaggctctcggc
ttcttctga

DBGET integrated database retrieval system