KEGG   Sinorhizobium meliloti RMO17: DU99_16625Help
Entry
DU99_16625        CDS       T03395                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
smer  Sinorhizobium meliloti RMO17
Pathway
smer00564  Glycerophospholipid metabolism
smer01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smer00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DU99_16625
Enzymes [BR:smer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DU99_16625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 FAD_binding_2 FAD_binding_3 NAD_binding_8 K_oxygenase GIDA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AIM00953
LinkDB All DBs
Position
3351601..3353112
Genome map
AA seq 503 aa AA seqDB search
MSEQTIFDVFVIGGGINGCGIARDAAGRGYSVALAEMSDFASGTSSGSTKLIHGGLRYLE
HYEFRLVREALMEREVLWAMAPHVIWPMRFVLPFHKGGPRPAWLIRLGLFLYDHIGGRKL
LPATKTLDMTRDPAGAPLKGLFTKAFEYSDGWVDDARLVVLNARDAADRGARIMARTRVV
SARREGGRWAIETESTETGARETMRARMLVNAAGPWVDRVLSEAVGNNDVRNVRLVQGSH
IVVKKKFDDPRAYFFQNPDGRIMFAIPYQDEFTLIGTTDRDFTGNPADVRISDAEIDYLC
RAASEYFSDPVGREDIVWTYSAVRPLFDDGASKAQEATRDYVLRVENGDAPLLNVFGGKL
TTYRRLAESALEKIGETIGEKGRKWTAVSHLPGGDFPAAGYDDEVAKLRTRYPFLTASHA
RRLVRLYGTRAAQLLGNAASEADLGKHFGADLYAAEVDWLIVQEWALRAEDVLWRRTKLG
LKFSRAQTAELEEYMRGAVNAAA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagagcagacgatcttcgacgtcttcgtcataggcggcggcatcaacggatgcggc
atcgcgcgtgatgcggctggccgcggatattccgtcgcgctggcggagatgagcgatttc
gcctccggaacatcctccggctcgaccaagctcatccatggcggcttgcgctatctcgaa
cattatgaattccgcctcgtgcgcgaagccctgatggagcgcgaagtcctctgggcgatg
gcgccgcacgtgatctggccgatgcgcttcgtgctgcccttccacaagggtggtccgcgg
ccggcatggctgatccgcctcggcctcttcctttacgatcatataggcggccgtaagctt
ctgccggcgacgaagacgctcgacatgacgcgcgatcccgcgggcgcaccgctgaagggc
ctcttcaccaaagcattcgaatattcggacggctgggtcgacgatgctcgcctcgtggtg
ctgaacgcgcgcgacgccgccgaccgcggcgcgaggatcatggcacgcacccgcgtcgtc
tcggcgcgccgcgagggcggccgttgggcaatcgaaaccgagagcacggagacgggcgcg
cgcgagacgatgcgcgcccgcatgctcgtcaatgccgcgggcccctgggtggaccgggtt
ctctccgaagcggtcggcaacaacgacgtccgcaatgtccgcctggtccagggcagccat
atcgtcgtgaagaagaagttcgacgatccgcgcgcctatttcttccagaacccggacggg
cggatcatgttcgccattccttaccaggacgagttcacgctgatcggaaccaccgatcgc
gatttcaccggcaatccggctgacgtgcgcatcagcgatgcggagatagattatctctgc
agggcggcgagcgaatatttcagcgacccggtcggcagagaggatatcgtgtggacctat
tccgccgtgcgcccccttttcgatgacggtgcgagcaaggcgcaggaggcgacccgcgac
tatgtgctgcgcgtcgagaacggcgatgcaccgctgctcaacgtcttcggcggcaagctc
accacctacaggcggcttgcggaatcggcgctcgagaagatcggcgagaccatcggggaa
aagggcaggaaatggacggccgtatcgcatctgccgggcggcgattttccggccgccggc
tatgacgacgaggtcgcgaagctcaggacgcgctatcctttcctgaccgcttcccacgcc
cgccggctggtacggctctacggcacgcgggcggcgcagcttctcggcaatgccgcgagc
gaggccgacctcggaaagcacttcggcgcggatctctatgctgcggaagtggattggctc
atcgtgcaggaatgggcattgcgcgcggaggacgtgctttggcgccgcacgaaactggga
ctgaagttttcgcgggcgcaaaccgcggaactggaggaatatatgcggggcgcggtcaac
gcggccgcctga

DBGET integrated database retrieval system