KEGG   Sinorhizobium meliloti RMO17: DU99_24185Help
Entry
DU99_24185        CDS       T03395                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
smer  Sinorhizobium meliloti RMO17
Pathway
smer00010  Glycolysis / Gluconeogenesis
smer00071  Fatty acid degradation
smer00350  Tyrosine metabolism
smer00625  Chloroalkane and chloroalkene degradation
smer00626  Naphthalene degradation
smer01100  Metabolic pathways
smer01110  Biosynthesis of secondary metabolites
smer01120  Microbial metabolism in diverse environments
smer01130  Biosynthesis of antibiotics
smer01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smer00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DU99_24185
  Lipid metabolism
   00071 Fatty acid degradation
    DU99_24185
  Amino acid metabolism
   00350 Tyrosine metabolism
    DU99_24185
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DU99_24185
   00626 Naphthalene degradation
    DU99_24185
Enzymes [BR:smer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DU99_24185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AIM02310
LinkDB All DBs
Position
pSymA:complement(1210753..1211781)
Genome map
AA seq 342 aa AA seqDB search
MAQTMKAAVVRQFRAPLTIEEMEVPTPGAGQVLVKYEATGVCHTDLHAANGDWPVKPAPP
FIPGHEGVGFVSAVGAGVRRVKEGDKVGVPWLHTACGYCTYCRTGWETLCASQSNTGYSV
NGTFAEFGLADPEFVGKIPDGLEFGAAAPVLCAGVTVYKGLKETEVRPGEWVAISGVGGL
GHMAVQYAKAMGMHVVAADIFEDKLALAKQLGADIAINGKSEDAIEQVQKATSGGVHGVL
VTAVSPAAMEQAFGFLRSKGTMVLVGLPPGMMSLPVFETVLKRITVRGSIVGTRQDLEES
LVFAAEGKVKPYFSWESLENINDIFHRMEAGKIDGRIVVRLQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcacagacaatgaaggcggctgtcgtacgccagttccgcgctccgctgaccatagag
gagatggaagtcccaacgcctggcgcggggcaggtcctggtaaaatatgaagcgacgggc
gtgtgccataccgatttgcatgcggcaaacggcgattggcccgttaagccggccccgccc
tttattccagggcatgagggtgttggcttcgtctcagccgtgggcgccggcgtgaggaga
gtgaaagaaggtgacaaggttggggtgccatggctccacaccgcttgcggttactgtacc
tattgccggaccggttgggaaacgctgtgcgcttcgcaatcgaacaccgggtactcagtg
aacggcaccttcgcggagttcggactggcagatcccgagttcgtcggaaagattcctgat
gggttggaattcggagccgccgcgcccgttctctgcgcgggagtgaccgtctacaagggg
ctgaaggaaacggaagtccgtcccggtgaatgggtggccatctcgggcgtcgggggtctc
ggccacatggcggtgcaatatgccaaggcaatgggaatgcacgtagtggccgccgacata
ttcgaagacaagctggcgctggctaagcaacttggcgccgacatcgcaataaacggcaag
tcagaagatgcaatcgagcaggtacagaaggccacgagcggcggcgttcacggagtgctc
gtgaccgctgtctctcccgccgccatggaacaggcctttggtttcctgcgatcgaaaggt
acgatggtcttggtcggccttccccccggaatgatgtccttgccggttttcgagaccgtc
ctgaaacgcataaccgtgcgtggatcaatcgtgggcacccgtcaagaccttgaggaatcg
ctcgtgttcgcggcggaaggcaaggtaaagccttatttctcgtgggagagcctcgagaac
atcaacgacatctttcatcgcatggaagcgggcaagatcgacggtcgcatagtcgtgcga
ttgcaatag

DBGET integrated database retrieval system