KEGG   Sinorhizobium meliloti RMO17: DU99_31335Help
Entry
DU99_31335        CDS       T03395                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
smer  Sinorhizobium meliloti RMO17
Pathway
smer00630  Glyoxylate and dicarboxylate metabolism
smer00710  Carbon fixation in photosynthetic organisms
smer01100  Metabolic pathways
smer01120  Microbial metabolism in diverse environments
smer01200  Carbon metabolism
Module
smer_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:smer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DU99_31335
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    DU99_31335
Enzymes [BR:smer01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     DU99_31335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AIM03661
UniProt: A0A222HD49
LinkDB All DBs
Position
pSymB:complement(1264504..1265760)
Genome map
AA seq 418 aa AA seqDB search
MLRITYRIETPGDVEFLAKKIASDQSTGTFVPVPGETEELKARVAARVLAIRHLEPADRA
SWPDEAGSATRFNRADAEIAFPLDAVGTDLSALMTIAIGGVYSIKGMTGIRIVDMKLPPE
FAAAHPGPQFGVVGSRRLTGVEGRPIIGTIVKPALGLRPEETAVLVGELLSSGVDFIKDD
EKLMSPAYSPLSARIAAIMPRILDHEQKTGKKVMYAFGISHTDPDEMMRNHDLVVAAGGN
AAVVNINSVGMGGVAFLRKRSGLVLHAHRNGWDILTRHGGLGMEFSVWQQFWRLLGVDQF
QINGIRVKYWEPDESFVKSFEAVSTPLFTKDDCPLPVVGSGQWGGQAPETYARTGHTTDL
LYLCGGGIVSHPGGPGAGVRAVRQAWEAAVAGIPLADYARDHPELAQSLEKFADGKGA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgctacgcatcacctaccgcatcgagaccccgggagatgtcgaattcctggcgaagaag
atcgcaagcgaccagtcgaccggaacgttcgtgccggttccgggcgaaaccgaagagctg
aaggcgcgggtggccgcgcgcgtactggctatccgccacctcgaacccgccgatcgggcc
tcatggccggacgaggcgggaagcgccacgcgcttcaaccgcgccgatgcggagattgcc
ttcccgctcgatgcggtgggaacggatctttccgccttgatgaccattgcgatcggcggc
gtctattccatcaagggaatgaccggcatccgcatcgtggatatgaagctgccgccggag
ttcgcggctgcgcatccgggtccgcagttcggtgtcgtcggcagccggcgcctgaccggt
gtcgaaggccgcccgatcatcggcacgatcgtcaagccggcgctgggtttgcggccagag
gaaaccgccgtactcgtcggcgagctgctttcctccggggtggatttcatcaaggacgac
gagaagttgatgagcccggcctattcgccgctgagtgcgcggatagcagccatcatgccg
agaatcctcgaccacgagcagaagaccggcaagaaggtcatgtatgccttcggcatatcc
cataccgatcccgacgagatgatgcgaaaccacgatctggtggtcgcggccggcggcaat
gcggcggtcgtcaacatcaattccgtcggaatgggcggcgtcgccttcctgcgcaagcgc
tccggcctcgtgctccacgcccatcgcaacggctgggacatcctcacgcgccatggcggt
ttgggaatggagttttcggtctggcagcagttctggcggctcctcggggtggatcagttc
cagatcaacggcatccgcgtcaaatactgggagcctgacgagagcttcgtgaagtccttc
gaggcggtgagcacgccgctctttaccaaggacgattgtccgctgccggtcgtggggtcg
ggccaatggggcggacaggcgcccgagacctatgcacggaccgggcacacgaccgatctg
ctctatctctgcggcggcggcatcgtcagccatccgggcggacccggcgccggcgtcagg
gccgtacgtcaggcctgggaggcggcagtcgccgggatcccgctggcggattatgccagg
gatcaccccgaactggcgcaatcgctcgaaaaattcgccgacggcaagggcgcctga

DBGET integrated database retrieval system