KEGG   Streptobacillus moniliformis: Smon_0709Help
Entry
Smon_0709         CDS       T01125                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
smf  Streptobacillus moniliformis
Brite
KEGG Orthology (KO) [BR:smf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Smon_0709
Enzymes [BR:smf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Smon_0709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_binding_2 FAD_oxidored Thi4 FMO-like NAD_binding_8 DAO K_oxygenase Lycopene_cycl FAD_binding_3 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ACZ01182
UniProt: D1AY06
LinkDB All DBs
Position
802745..803689
Genome map
AA seq 314 aa AA seqDB search
MSKILKFDETIIYDTIIVGAGPAAVSAAIYAVRKGLKTAMIGEDIGGQILDTNEIENIIG
VPLTNGFDYATELEKHMSEYEIYFYKGHRVKEIINDDKLKKIITDDNKEVLTKTIIISTG
AKWRQLGIPGEKEYTGKGVHYCSTCDGPFYRNKDVIIVGGGNSGVEAAIEISNIAKSVVL
VEYMDELKADKVLQDRLFTLENVKIYLSTGVTEIIGNEYAEISKLKNRHTSEEFELKMDG
LFVEIGLSANSDLVKNIVETNKAGEILIDEMNMTSIPGIFAAGDCTNTKHKQIIIAMGEG
AKAALSAFEYVIKN
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaattttaaaatttgatgaaacaattatttatgatactattatagtaggagca
gggccagcagcagtttctgctgcaatatatgcagtaagaaaaggattaaaaactgctatg
ataggtgaagacataggaggacaaattttagatacaaatgaaatagaaaatattataggt
gttcctttaacaaatggttttgattatgcaacagaattggaaaagcatatgtctgaatat
gaaatctatttctataagggacatagagtaaaagagattattaatgatgataaattgaaa
aaaataattacagatgataataaagaggtattaactaaaactatcataatttcaacagga
gctaaatggagacaacttggtatcccaggtgagaaagaatatacaggaaaaggagtacat
tactgctcaacttgtgatggacctttttatagaaataaggatgtaattattgtaggtgga
ggaaattctggagtagaagcagctatagagatttctaatattgctaaaagtgttgtatta
gtagagtatatggatgaattaaaggctgataaagtattacaggatagattatttacttta
gaaaatgtaaaaatatatctatcaactggtgttacagaaattattggaaatgaatatgct
gaaatttcaaaattaaaaaatagacatacttcagaagaatttgaattaaaaatggatgga
ctttttgtagaaataggattaagtgcaaattcagatttagtaaaaaatattgttgaaact
aacaaagcaggtgagatattaattgatgaaatgaatatgacatcaattccaggtattttt
gctgctggagattgtactaacacaaaacataaacaaataataattgctatgggagaaggg
gctaaagctgctttaagtgcatttgaatatgtaattaaaaactaa

DBGET integrated database retrieval system