KEGG   Streptobacillus moniliformis: Smon_1072Help
Entry
Smon_1072         CDS       T01125                                 

Definition
(GenBank) hypothetical protein
Organism
smf  Streptobacillus moniliformis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RE_ApaLI RapH_N
Motif
Other DBs
NCBI-ProteinID: ACZ01534
UniProt: D1AUX4
LinkDB All DBs
Position
complement(1179980..1180627)
Genome map
AA seq 215 aa AA seqDB search
MKNIEKIYNKIKELADKYSNNLKFKVDERIEEMKNDDKSHYLIYRVLGVSTKEGELIDIY
KNKGRFLYKYAGSFLEEATILCFKHKYTNSKKIKVNNTLSNRPKTFEIDCLVDNKAYEIK
WKDATTDGDHITKEHTRVKVIQSHGYTPIRIMFYYPNRSQAIKIQETLKTLYIGVNGQYY
YSDLAWDYIKKETDIDLLGILQKIADERNNCNANK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatattgaaaaaatatataataaaataaaagaattagctgataaatatagtaat
aatctaaaatttaaagttgatgaaagaatagaagaaatgaaaaatgatgataaatctcat
tatttaatatacagggttttgggagtgtctacaaaagagggggaattaatagatatttat
aaaaataaaggaagatttctgtataaatatgcaggttcttttttagaagaagcaactata
ttatgttttaaacataaatatactaattcaaagaaaattaaggtaaataatactttaagt
aatagaccaaaaacttttgaaatagattgtcttgtggacaataaagcttatgaaataaaa
tggaaggatgctacaacggacggtgatcatataactaaagaacatacaagagttaaggtt
attcaatctcatgggtatactccaataagaataatgttttattatcctaatcgtagccaa
gcaataaaaatacaagaaactttaaaaacgctatatataggagtaaatggtcaatattat
tatagtgatttggcttgggattatataaaaaaagaaacagacattgatttattgggcata
ttacaaaaaattgctgatgaaaggaataattgtaatgcaaataaatga

DBGET integrated database retrieval system