KEGG   Streptobacillus moniliformis: Smon_1078Help
Entry
Smon_1078         CDS       T01125                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
smf  Streptobacillus moniliformis
Pathway
smf00473  D-Alanine metabolism
smf00550  Peptidoglycan biosynthesis
smf01100  Metabolic pathways
smf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Smon_1078
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Smon_1078
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Smon_1078
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smf01011]
    Smon_1078
Enzymes [BR:smf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Smon_1078
Peptidoglycan biosynthesis and degradation proteins [BR:smf01011]
 Precursor biosynthesis
  Amino acid ligase
   Smon_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 RimK GARS_A VIGSSK HMGL-like
Motif
Other DBs
NCBI-ProteinID: ACZ01540
UniProt: D1AUY0
LinkDB All DBs
Position
complement(1187630..1188529)
Genome map
AA seq 299 aa AA seqDB search
MRIGVIYGGVSTEREVSINTGKEIIANLDKSKYEVVEIEISKKEDIFKVVDLNLDFAYIA
LHGEFGESGDVQAILETAGIKYSGSGILSSAICMDKDITKVLAKNSGVRIINGRCIKKGE
NIKFSDLNLGEKIILKPNRGGSSIGVYFATNDEELEYGLNEIFKLGENEVLIEEMKSGIE
ISVPIIAGKVFPTLLIEPLKDTFFDYTSKYENGGAKEYVYFFEESLQNEINDFTIKAYNA
VKCKGFARIDYILVDNKAYFLEVNTLPGMTKNSLLPKSTLYMGYSYSETLDLLIKESIK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagaataggtgtaatttatggtggagtttctactgaaagagaagtttctataaataca
ggtaaagaaataattgctaatttagataaatcaaaatatgaagtagtagaaatagaaata
tctaaaaaagaagatatatttaaggtagtagatttaaatcttgattttgcatatatagcc
ttacatggtgaatttggtgaaagtggagatgttcaagctatacttgaaacagcaggaata
aaatattctggtagtggtatactttcaagtgctatatgtatggataaggatataactaag
gtgttagctaaaaattctggagttagaattataaatggaagatgcataaaaaaaggagaa
aatattaaattttctgatttaaatctaggtgaaaagataatacttaaacctaatcgtggt
ggttctagtataggagtgtattttgcaactaatgatgaagaattagaatatggacttaat
gagatatttaaattaggagaaaatgaagtattgatagaagaaatgaaatcaggtatagaa
atttcagttcctattatagcgggaaaagtttttcctaccttattaatagaaccattaaaa
gatactttctttgattacacatcaaaatatgaaaatggtggagctaaggaatatgtatac
ttctttgaagagagtttacaaaatgaaataaatgattttactattaaagcatacaatgca
gttaaatgtaagggatttgcaagaatagactatattttagtggataataaggcatatttc
ttagaagttaatactcttcctggtatgactaaaaattctttacttccaaaatcaacccta
tatatgggttattcttattcagaaactttagatttattaataaaggagtctataaaataa

DBGET integrated database retrieval system