KEGG   Sinorhizobium meliloti Rm41: BN406_00705Help
Entry
BN406_00705       CDS       T02332                                 

Gene name
yfcG
Definition
(GenBank) putative disulfide bond reductase yfcG
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
smi  Sinorhizobium meliloti Rm41
Brite
KEGG Orthology (KO) [BR:smi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BN406_00705 (yfcG)
Enzymes [BR:smi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     BN406_00705 (yfcG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: CCM66750
LinkDB All DBs
Position
738572..739273
Genome map
AA seq 233 aa AA seqDB search
MTAPIELYYWPTPNGWKITIMLEELGVPYVVKYINIGRGDQFQPDFLKISPNNRMPAIVD
PDGPGGESISVFESGAILQYLGRKYGKFYPSDERARVDVEQWLFWQVGGLGPMAGQAHHF
RQYAPERIAYGIDRYTNEVNRLYGVMNKRLADRPFLAGDYSIADMAAIGWVIPHENQGQD
LNEFPNLKRWFDAVLARPAVKKAIEVGKEERARQKSLAEDEEAQKVLFGQRAR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctccgatcgagctttattattggcccacgccgaacggctggaagatcaccata
atgctggaggagctcggcgttccctacgtcgtcaagtacataaatatcggccggggcgat
cagttccagccggacttcctgaagatctcgccgaacaaccggatgccggcgatcgtcgat
ccggacggtccgggtggcgagtccatctccgtattcgaatcaggagcgatcctgcagtat
ctcggccgcaaatacggcaagttctatccgtccgacgagcgcgcccgtgtcgacgtcgag
caatggctcttctggcaggtgggcggactggggccgatggcggggcaggcacaccacttc
cgccaatatgccccggaaaggatcgcctacggcatcgaccgctataccaatgaagtgaac
cgcctctacggcgtgatgaacaagaggctcgccgaccgaccgttcctcgctggcgattac
tcgatcgcagacatggccgcgatcggctgggtgattccgcacgagaatcagggccaggac
ctcaacgaattcccgaatctgaagcgctggttcgacgccgtgcttgcgcgaccggcggtg
aagaaggccatcgaggtgggcaaggaggagcgggcccgccagaagagcctcgccgaggac
gaagaggcgcagaaggttctgttcggccaacgcgcccgctga

DBGET integrated database retrieval system