KEGG   Sinorhizobium meliloti Rm41: BN406_03940Help
Entry
BN406_03940       CDS       T02332                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:smi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BN406_03940
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:smi03400]
    BN406_03940
Enzymes [BR:smi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BN406_03940
DNA repair and recombination proteins [BR:smi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BN406_03940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: CCM70222
LinkDB All DBs
Position
pSYMA:430078..432714
Genome map
AA seq 878 aa AA seqDB search
MADNLSKYRAKRDFKKTREPSGEAQVKQSNRRRFVIQKHDATRLHYDLRLELDGVFKSWA
LTKGPSLDPSDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVMLWDRGYWEPEGRKSPEE
ALKKGDFKFTLHGKRLHGSFVLVRMRNDRDGGKRTNWLLIKHRDDYSVDENGAAILEENA
TSIASARSMEQIAEGTGRKPRPFMMANADVEADAVWDSKHGLAAEERKKGSRRDLATSTA
ADLPDFIEPQLCETLARPPASDDWLHEIKFDGYRIQMRVADGKVTLKTRKGLDWTAKYPE
IADAASELPDCIIDGEICALDDNGAPDFAALQAALSEGKTGNLVYFAFDLLFDGGEDLRS
MRLVERKKRLEDFLAAGSDDPRIRYVDHFESGGDAVLRSACKLSLEGIVSKQMDAPYESG
RTDTWAKSKCRAGHEVVIGGYARTNGKFRSLLVGVHRGDHFVYVGRVGTGFGAAKVERFF
PKLKALEASKSPFTGIGAPKKEKEVTWLKPELVAEIEFAGWTTDGLVRQAAFKGLREDEP
AKEVQADKPSPPAKTDTPEPGPSAKTRPVRRKGAKAEVMGVLISSPDKPLWPDAGDGEPV
TKEDLARYHEAVGTWLIDHIKGRPCSIIRAPDGIGGEQFFQRHAMQGTSNLLELVKVFGD
KKPYLQIDRIEGLAAIAQIGGIELHPWNCEPGKPEVPGRLVFDLDPGPDVPFATVVAAAR
EMRDRLDELGLVSFCKTTGGKGLHVVTPFAVNKRTPLSWAEAKGFAHEVCEQMARDNPDL
YLIKMSKSLRGGRIFLDYLRNDRMATAVAPLSPRARPGATVSMPLNWTQVKSDLDPKRFT
VRTVPALLAKTTAWQDYCDGERPLEQAIKRLGKSRRAA
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaatctttcgaaataccgtgccaagcgcgatttcaagaagaccagagaacca
agcggcgaggctcaggtcaagcagtcgaaccgccggcggttcgtgatccagaagcacgac
gccacccggcttcactatgatctgcggcttgaactggacggggtgttcaagagctgggcg
ttgaccaagggcccatcgctcgatcctagtgacaagcgactggccgtcgaagtcgaagat
cacccgctcgactatggcgacttcgaaggcacgattccaaagggccagtatggcggcggc
acggtcatgctatgggaccgcggctattgggagccagaaggtaggaagtcacctgaagag
gccctgaagaagggcgacttcaagttcacgcttcatggcaagcggctgcatggcagcttc
gtcctggtgcggatgcgcaacgatcgcgatggcggcaagcggaccaactggctgctcatc
aaacatcgtgacgattactccgttgacgagaacggcgcggcaatcctggaggagaacgcg
acttccatcgcctccgcccgcagcatggagcagatcgccgagggcacgggccgcaagccg
cgaccgttcatgatggcgaacgcggatgtcgaggcagatgccgtctgggacagcaagcat
ggcttggcagcggaagagcgcaagaaggggtctcgcagggatctcgcgacctccacggca
gccgacctgccggattttatcgagccgcagctctgcgagacgcttgcgcggccgccggcc
agcgacgactggctgcatgagatcaagttcgacggttatcggatccagatgcgggttgcc
gacggtaaggtgacgctgaagacgcgcaagggtctcgactggaccgcgaaatatccagag
atcgccgatgctgcgtccgaattgcccgattgcatcattgatggcgaaatctgcgccctc
gacgacaatggcgcgcccgatttcgcagcactccaggccgcgctctcggaaggcaagacc
ggcaaccttgtctacttcgccttcgacctgctgtttgatggcggcgaggacttgcggtcg
atgcgattggtcgagcggaagaagcggctcgaagacttcctcgcggccgggagcgacgat
ccgcgtatccgctacgtcgatcacttcgaatccggcggtgacgcggtgctccgctccgcc
tgcaagctgtcgctcgaaggtatcgtctccaagcagatggatgcgccctacgaatcgggc
cgcaccgacacctgggcgaagtcgaaatgccgggctggtcatgaggtggtgatcggtggc
tatgctaggaccaacggcaagttccgatctctcctggtcggcgttcaccgcggcgatcac
ttcgtctatgtcggccgggtcggcacgggcttcggcgccgcgaaggtcgagcggttcttt
cccaagctgaaggcgttggaagcatcgaagtcacccttcaccggcatcggtgcgccgaaa
aaggagaaggaagtcacctggctgaaaccggagctcgttgccgagatcgagttcgccggc
tggacgaccgacggcctagttcgtcaggcagccttcaaaggcctgcgcgaggacgagccg
gcgaaagaggtccaggccgacaagccgtcaccgcccgccaagaccgacacgcccgagcct
gggccgtccgccaagaccagaccggtgcggcgcaagggcgccaaggccgaggtcatgggc
gtcctcatctccagtcccgacaagccactctggccggacgccggcgatggcgagcccgtg
accaaggaagatctcgcccgctaccatgaagccgtcggaacctggctcatcgatcacatc
aagggccggccctgctcgatcattcgagcacccgacggcattggcggcgagcagttcttc
cagcgccatgcgatgcaaggcacctccaatctgctcgaactggtgaaagtcttcggggac
aagaagccctaccttcagatcgatcggatcgaagggctcgcggcgatcgcccagatcggc
ggaatcgaactacatccctggaactgcgaacccggcaagccggaagtgcccggccgtctg
gtgttcgatctcgatcctggtcccgacgtgccgtttgcgacagtggtcgcggccgcgcgg
gaaatgcgtgaccggctcgacgagctcggcctcgtcagtttctgcaagacgaccggcggg
aagggattgcatgtcgtcacgccattcgctgtgaataagcgcacgcctctgtcatgggcc
gaggctaagggattcgcgcatgaagtttgcgagcaaatggcgcgcgataatcccgatctt
tatctcatcaagatgagcaagagcctcaggggcggaaggatcttcctcgattatctccgc
aacgaccgcatggcgaccgccgtggcgccactgtcgccgcgcgcacggcccggcgccaca
gtctcgatgccgctcaactggacgcaggtgaagtccgatctcgacccgaagcggtttacc
gtccgcaccgtgccggcgctgcttgcgaaaaccactgcctggcaagactattgtgatggc
gagcggccgctcgaacaggcgatcaagcgcctcggaaaatcaagacgggctgcgtga

DBGET integrated database retrieval system