KEGG   Sinorhizobium meliloti Rm41: BN406_04054Help
Entry
BN406_04054       CDS       T02332                                 

Gene name
nrtB
Definition
(GenBank) Nitrate transport permease protein nrtB
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00910  Nitrogen metabolism
smi02010  ABC transporters
Module
smi_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:smi00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BN406_04054 (nrtB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BN406_04054 (nrtB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smi02000]
    BN406_04054 (nrtB)
Transporters [BR:smi02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    BN406_04054 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Romo1
Motif
Other DBs
NCBI-ProteinID: CCM70336
LinkDB All DBs
Position
pSYMA:complement(544964..545857)
Genome map
AA seq 297 aa AA seqDB search
MSVTNLKLKPQATPQTSAQVIALGQTASRGIDGRLSRFVTQTVTNLLPLLVTLTFFTLAW
QLICSSPESSLPAPSRVLEESWELIAHPFYIGQGVDQGLFWHVFASLQRVALGYAMAAAV
GVALGTLVGQSALAMRGLDPIFQVLRTVPPLAWLPLSLAAFQDGTPSAIFVIFITAIWPI
IINTAVGIRNIPQDYQNVAKVLRLNGFEYFGKIMLPAAAPYIFTGLRIGIGLSWLAIVAA
EMLIGGVGIGFFIWDAWNSSLISDIIVALIYVGIVGFLLDRLIALVGRAVTRGTANA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcaccaatctcaagctcaaaccccaggcgactccgcagacctccgctcaggtc
atcgctctcgggcagacggcgagccgcggcatcgatggccgtctgtcgcgctttgtcacc
cagacggtcaccaacctcttgccgctgctcgtcacactgacgttcttcacccttgcctgg
cagctcatctgctcgtcgcctgaatcgagccttccggccccgtcgcgtgtcctcgaggaa
agctgggaactgatcgcacatcccttctacatcggtcagggtgtcgatcagggtctgttc
tggcacgtgttcgccagcctgcagcgcgtcgcgctgggctacgcgatggctgcggcggtc
ggcgtcgcgcttgggacgctcgttggccagagcgcgctcgcgatgcgcggcctcgatccg
atcttccaggtgcttcgcaccgtgccgccgctcgcctggctgccgctttcactcgccgcc
ttccaggatggcaccccttcggcaatcttcgtcatcttcatcacggcgatctggccgatc
atcatcaacaccgcggtcggcatccgcaacattccgcaggattaccaaaacgtcgccaag
gtgctgcgactgaacggcttcgaatatttcggtaagatcatgctgccggccgctgccccc
tacatcttcaccggtcttaggatcggtatcggtctctcctggctggcgatcgtggcggcc
gagatgctgatcggcggcgtcggcatcggcttcttcatctgggatgcgtggaactcgtcg
ctgatcagcgacatcatcgtggcgctcatctatgtcggcattgtcggctttctcctcgac
cgcctcatcgcactcgtcggccgcgccgtcacccgcggcactgcaaacgcttag

DBGET integrated database retrieval system