KEGG   Sinorhizobium meliloti Rm41: BN406_06445Help
Entry
BN406_06445       CDS       T02332                                 

Gene name
ompR3
Definition
(GenBank) Transcriptional regulatory protein OmpR
  KO
K02483  two-component system, OmpR family, response regulator
Organism
smi  Sinorhizobium meliloti Rm41
Brite
KEGG Orthology (KO) [BR:smi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:smi02022]
    BN406_06445 (ompR3)
Two-component system [BR:smi02022]
 OmpR family
  Unclassified
   BN406_06445 (ompR3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: CCM72727
LinkDB All DBs
Position
pSYMB:1496220..1496957
Genome map
AA seq 245 aa AA seqDB search
MEHIDHILIVDDDREIRELVSAYLKKNGLRVTAVADGRQMRTFLEANTVDLIILDLMMPG
DDGLVLSRELRVGRHKATPIVMLTARSDEMDRIIGLEMGADDYIAKPFSARELLARIKAV
LRRARMLPANLQVSEAGQLLRFGQWKLDTTARHLIDADGTAIALSGAEYRLLRVFVDHPQ
RVLNRDQLLNLTQGREAELFDRSIDLLVSRVRQRLGDDAREPTYIKTVRSEGYVFSVPVE
IMEPR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggagcacatcgatcacatcctgatcgtcgatgacgatcgggaaatccgcgagcttgtg
tccgcttacctgaagaagaacggtctgcgggtgaccgccgttgccgacgggcggcagatg
cggaccttcctcgaggcgaatacagtcgatctgatcatcctcgatctgatgatgccgggc
gacgacggcctcgtcttgagccgcgagctgcgtgtcggcagacacaaggcgacgcccatc
gtcatgctgaccgcccgctcggacgagatggaccgcatcatcgggctggaaatgggcgcc
gacgactatatcgccaaacccttctcggcgcgcgaactgctcgcccgcatcaaggcggtc
ctgcggcgcgcgcggatgctgccagcgaacctgcaggtctcggaggcaggtcagctgttg
cgtttcggccaatggaagctggacacgacggcaaggcatctcatcgatgcggatggtact
gcgattgcactcagcggcgccgaataccggctgctgcgcgtcttcgtcgaccacccgcag
cgcgtcctcaaccgcgatcagctcctcaacctcacacaggggcgcgaggccgagctcttc
gaccgatcgatcgatctcctggtcagccgggtacgccagcgcctcggcgacgatgcccgg
gaaccgacctatatcaagaccgtccgcagcgaaggctatgttttctcggtgccggtcgag
atcatggagccccgctga

DBGET integrated database retrieval system