KEGG   Sinorhizobium meliloti Rm41: BN406_06465Help
Entry
BN406_06465       CDS       T02332                                 

Gene name
cbbL
Definition
(GenBank) Ribulose bisphosphate carboxylase large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00630  Glyoxylate and dicarboxylate metabolism
smi00710  Carbon fixation in photosynthetic organisms
smi01100  Metabolic pathways
smi01120  Microbial metabolism in diverse environments
smi01200  Carbon metabolism
Module
smi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:smi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BN406_06465 (cbbL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BN406_06465 (cbbL)
Enzymes [BR:smi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BN406_06465 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: CCM72747
LinkDB All DBs
Position
pSYMB:1517306..1518766
Genome map
AA seq 486 aa AA seqDB search
MNADAKTEIKGRERYKAGVLKYAQMGYWNGDYEPKDTDLIALFRITPQDGVDPIEAAAAV
AGESSTATWTVVWTDRLTACDQYRAKAYRVDPVPGTPGQYFCYVAYDLILFEEGSIANLT
ASIIGNVFSFKPLKAARLEDMRLPVAYVKTFRGPPTGIVVERERLDKFGKPLLGATTKPK
LGLSGKNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRYLYCMEAVNHASAVTGEVKG
HYLNITAGTMEEMYRRAEFAKELGSVIVMVDLIVGWTAIQSISEWCRQNDMILHMHRAGH
GTYTRQKNHGISFRVIAKWLRLAGVDHLHAGTAVGKLEGDPPTVQGYYNVCREMKNEVDL
PRGLFFEQDWADLKKVMPVASGGIHAGQMHQLLDLFGDDVVLQFGGGTIGHPMGIQAGAT
ANRVALEAMVLARNEGRDIAHEGPEILRAAAKWCKPLEAALDIWGNISFNYTPTDTSDFV
PSVTAA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgacgcaaagacagagatcaagggccgcgaacgttacaaggccggcgtgctg
aaatacgcccagatgggctactggaacggagactacgagccgaaggacaccgacctgatc
gcgctcttccggatcacgccgcaggacggcgtcgatccgatcgaagcggccgccgccgtt
gccggcgaaagctcgacggccacatggacggtcgtctggaccgatcgcctgacggcctgc
gatcaataccgcgccaaggcctaccgggtggatccggtgccgggaacgccggggcagtac
ttctgctatgtcgcctacgacctcatcctcttcgaggaagggtcgatcgcgaacctgacg
gcatcgatcatcggcaacgtcttctcgttcaagccgctgaaggcggcaaggctcgaggat
atgcgcctgcccgtcgcctacgtgaagaccttcaggggtccgccgaccggcatcgtcgtc
gagcgcgaacggctcgacaagttcggcaagccgctgctgggtgccacgaccaagccgaag
ctcggcttgtctggcaagaactatggccgcgtcgtgtatgaggggctgaagggcggtctc
gacttcatgaaggacgacgagaacatcaattcgcagcccttcatgcattggcgcgaccgc
tacctctactgcatggaggccgtcaatcacgcttccgccgtcaccggcgaggtgaagggg
cactacctcaacatcactgccggcacgatggaggaaatgtaccggcgcgccgaattcgcc
aaggaactcggctcggtcatcgtcatggtcgatctcatcgtcggttggactgctatccag
tcaatatcggaatggtgccggcagaacgacatgatcctgcacatgcaccgggccggtcac
ggcacctatacgcggcagaagaaccacggcatctccttccgcgtgatcgccaaatggctg
cggctcgccggcgtcgaccacctgcatgcgggcacggccgtaggcaagctcgagggcgac
ccgccgacggtgcagggctactacaatgtctgccgcgaaatgaagaacgaggtcgacctt
ccgcgcggtctgttcttcgagcaggactgggcggacctcaagaaggtcatgcccgtcgcc
tcgggcggcatccatgccggtcagatgcaccagctgctcgatcttttcggcgacgatgtc
gtactgcagttcggcggcggcacgatcgggcatccgatgggcatccaggcaggggccacc
gccaaccgcgtcgccctggaagccatggtgcttgcccgcaacgagggccgcgacatcgcc
cacgaaggtcccgagatcctgcgggcggcggcgaagtggtgcaaaccgctggaagcggcc
ctcgatatctggggcaatatcagcttcaactacaccccgaccgatacgtcggatttcgtg
ccgagcgttaccgcggcctga

DBGET integrated database retrieval system