KEGG   Sphingosinicella microcystinivorans: SmB9_19720Help
Entry
SmB9_19720        CDS       T05811                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
smic  Sphingosinicella microcystinivorans
Brite
KEGG Orthology (KO) [BR:smic00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SmB9_19720
Enzymes [BR:smic01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SmB9_19720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored HI0933_like FAD_binding_2 AlaDh_PNT_C NAD_binding_7 K_oxygenase DAO FAD_binding_3 Glutaredoxin Thi4 FMO-like NAD_binding_8 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: BBE34314
LinkDB All DBs
Position
2060651..2062231
Genome map
AA seq 526 aa AA seqDB search
MLDDNLKQQLKAYLQNITQPIELVASLNDSAKSAEMNTLLEEIAALSEKVSVARKDDDKR
RPSFMIRRVGTDIGVRFAGLPMGHEFTSLVLALLQVGGHPSKAAQDVIEQVKALDGDFVF
ETYFSLSCQNCPDVVQALNLMAVLNPRIKHTAIDGALFKDEVDERKVMAVPTVFLNGEPF
ASGRMELEQIVAKIDTGAQARAAEKINGKAPFDVLVVGGGPGGAAAAIYAARKGIRVGVA
AERFGGQVLDTMGIENFISVQHTEGPKLAAQLEQHVKDYDVDIMNLQKAEKLIPARAAGG
LHEVRLENGASLKARTVVLATGARWRQMNVPGENDYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQRKLASLPNVKVITSALTTEVLGDG
EKVTALTYKDRNSDDLHQIELEGIFVQIGLVPNTEWLKDAVALSPRGEIEVDHRGETSQP
GILAAGDCTTVPYKQIVIAMGEGSKAALSAFDYLIRTVPAEETQAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgacaacctgaaacagcagctgaaagcctatctgcagaacatcacgcagccg
atcgagctggtggcgtcgctgaatgacagtgcgaaatccgcggagatgaacacgctcctc
gaagaaatcgcagcgctttcggaaaaggtaagcgtcgctcgcaaggatgacgacaagcgg
cggcccagcttcatgatccgccgtgtcggcacagatatcggcgtgcgcttcgcaggcctc
cccatgggccacgagttcacctcgcttgtgctcgcgctgctgcaggtcggcggacatccg
tcgaaggccgcgcaggacgtgatcgaacaggtgaaggcgctggacggcgacttcgtgttc
gaaacctatttctcgctgtcgtgccagaattgcccggacgtggtgcaagcgctgaacctg
atggcggtgctcaatccccgcatcaaacacaccgcgatagatggcgcgctcttcaaggac
gaggtcgacgagcgcaaggtgatggcggtgccgacggtgttcctgaacggcgagccgttc
gcttcgggccgcatggagctggagcagatcgtcgcgaagatcgacacgggcgcgcaggcg
cgcgcggcggagaagatcaacggcaaggcgccgttcgacgtgctcgtcgtcggcggcggc
cccggcggtgcggcggcggcgatctatgccgcgcgcaagggcatccgtgtgggtgtggcg
gccgagcgtttcggcggacaggtgctcgacacaatgggcatcgagaacttcatttccgtg
cagcacaccgaaggccccaagctcgcggctcagcttgagcagcacgtgaaggactatgac
gtcgacatcatgaaccttcagaaggccgaaaagctgatcccggcacgcgcggcgggcggg
ctgcacgaagtccggctggagaacggcgcatcgctgaaagcgcgaacggttgtgctcgcc
accggtgcgcgctggcggcagatgaacgtgccgggcgagaacgactatcgcaacaagggc
gtggcctattgcccgcactgcgacgggccgctgttcaagggcaagcgcgtcgcggtgatc
ggcggcggcaactcgggcgtggaagctgcgatcgacctcgcggggatcgtcgcgcatgtc
acgctgatcgagttcgacagccagctccgcgcggacgcggtgttgcagcgcaagctcgcc
agcctgccgaacgtgaaggtcatcacgtccgctctgaccaccgaagtgctgggcgacggc
gaaaaggtgacggcgctcacctacaaggaccggaatagcgacgatctgcaccagatcgag
ctggaaggcattttcgtgcagatcggcctcgtgcccaacacggagtggctgaaggacgcg
gttgcgctctctccgcgcggcgagatcgaggtcgatcaccgcggcgaaacgagccagccg
ggcatacttgcggccggcgattgcaccaccgtgccctacaagcagatcgtgatcgcaatg
ggcgaggggtcgaaggcagcgctttccgcattcgactatctgatccgcaccgtgcctgcg
gaagaaacgcaggcagcgtaa

DBGET integrated database retrieval system