KEGG   Sphingosinicella microcystinivorans: SmB9_21930Help
Entry
SmB9_21930        CDS       T05811                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
smic  Sphingosinicella microcystinivorans
Pathway
smic00020  Citrate cycle (TCA cycle)
smic00190  Oxidative phosphorylation
smic00650  Butanoate metabolism
smic01100  Metabolic pathways
smic01110  Biosynthesis of secondary metabolites
smic01120  Microbial metabolism in diverse environments
smic01130  Biosynthesis of antibiotics
smic01200  Carbon metabolism
Module
smic_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smic_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
smic_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:smic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SmB9_21930 (sdhB)
   00650 Butanoate metabolism
    SmB9_21930 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SmB9_21930 (sdhB)
Enzymes [BR:smic01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SmB9_21930 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     SmB9_21930 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer2
Motif
Other DBs
NCBI-ProteinID: BBE34535
LinkDB All DBs
Position
2321646..2322431
Genome map
AA seq 261 aa AA seqDB search
MAEFTLPKNSKVNGKGKVHKAPEGATHIKTFKIYRWSPDDSANPRMDSYELDLDSCGPMV
LDALIKIKNEVDPTLTFRRSCREGICGSCSMNIDGSNTLACTKPIDEVKGDVAITPLPHM
EVVKDLVPDFKHFYAQYASIKPWLQTVSTTPSGKERIQSPEDREKLDGLYECILCACCST
GCPSYWWNSDKFLGPAILLQAYRWLADSRDEMTGERLDALEDPFRLYRCHTIMNCANVCP
KGLNPAKAIGEIKKMMVERQL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggccgaattcacgcttccgaagaacagcaaggtgaacggcaagggcaaggtgcacaag
gcccccgagggtgcgacgcatatcaagacgttcaaaatctatcgctggtcgcccgacgac
agcgcgaacccgcgcatggacagctacgagctcgacctcgacagctgcgggccgatggtt
ctcgacgcgctcatcaagatcaagaacgaggtcgaccccacgctgaccttccgccggtcg
tgccgcgaaggcatctgcggttcgtgctcgatgaacatcgacggctcgaacacgctcgcc
tgcacgaagccgatcgacgaggtgaagggcgacgtcgcgatcacgccgctgccgcatatg
gaggtcgtgaaagacctcgtgcccgacttcaagcacttctacgcgcagtacgcttcgatc
aagccgtggctgcagaccgtttccacgacgccctcgggcaaggagcgcatccagtccccg
gaagaccgcgagaagctggacgggctctatgagtgcatcctctgcgcctgctgctcgacc
ggttgcccgagctactggtggaactccgacaagttccttggcccggcgatcctgctgcag
gcctatcgctggctcgcagacagccgcgacgagatgaccggcgaacggctcgatgcgctg
gaagatcccttccggctctatcgctgccacacgatcatgaactgcgcgaacgtctgcccg
aagggtctcaacccggcaaaggcgatcggcgaaatcaagaagatgatggtggaacgccag
ctttag

DBGET integrated database retrieval system