KEGG   Sphingosinicella microcystinivorans: SmB9_23660Help
Entry
SmB9_23660        CDS       T05811                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
smic  Sphingosinicella microcystinivorans
Pathway
smic00473  D-Alanine metabolism
smic00550  Peptidoglycan biosynthesis
smic01100  Metabolic pathways
smic01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smic00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SmB9_23660
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SmB9_23660
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SmB9_23660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smic01011]
    SmB9_23660
Enzymes [BR:smic01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SmB9_23660
Peptidoglycan biosynthesis and degradation proteins [BR:smic01011]
 Precursor biosynthesis
  Amino acid ligase
   SmB9_23660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C
Motif
Other DBs
NCBI-ProteinID: BBE34708
LinkDB All DBs
Position
complement(2504429..2505400)
Genome map
AA seq 323 aa AA seqDB search
MLLAKHACGDGSPDMVDGNHAQYHHELRRTLEKIGLHVVAANSFDALFAEPDVDFVFPLL
NRAGFLNSEMLAPLLLQRLGIPYLGASPILRGLSDDKHLMKLVARQHAVPTSDWRILRRG
TDLAVVPALDAARYIIKPNASSASWGIGVSESWSGALAHAAHLHTAGHDAIIEPWLPLLD
VAVPVIGGRSQEPWLLPGMAYIPADPDALRSYEEKRSLTDQRDDPLEVLANSRVAERLYA
MTRALCRELWPFDYGRFEFRYDPATESVWFMEVNLSCNLWSKKSISRSAATLGIEHHELV
ESIVAHSLWRQGLMNTVSERLVA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttgcgaagcacgcctgcggcgatggcagtcccgacatggtggacggcaaccat
gcccagtatcaccatgaactgcgtcgcacgctcgagaagatcggcctccatgtcgtggcc
gccaacagtttcgacgcactctttgcggagcccgacgtcgatttcgtgtttccgctgctg
aatcgtgccgggttcctgaacagcgagatgctggcgccgctgctgctccagcggctcggc
atcccctatctcggcgcctcgccgatcctgcgcgggctttcggacgacaagcacctgatg
aagcttgtggcacggcagcacgccgtcccgacgtcagactggcgcatcctccgccgcggc
accgatcttgccgtcgtcccggcgctggatgcggcgcgctacatcatcaaaccgaatgcc
tcttcggcctcctgggggatcggtgtcagcgaaagctggtcgggggcgctcgcccacgcc
gcgcacctccacaccgcgggccacgacgcgatcatcgagccgtggctgcccctgctggat
gtcgccgtcccggttatcggcggacgatcgcaggagccgtggctcctgcctgggatggcg
tacatcccggccgatcccgacgcgcttcgcagctacgaggagaagcgctcactgaccgac
cagcgggacgacccgctggaggtgctcgccaattcccgcgtcgccgagcggctgtatgcg
atgacgcgcgcgctgtgccgggagctctggccgttcgattacggacgcttcgaatttcgc
tacgatcccgcgaccgaaagcgtttggttcatggaagtgaacctctcgtgcaatctctgg
tcgaaaaagagcatttcccgttccgccgcgacgctcggcatcgagcatcacgaactcgtc
gagtccatcgtcgcccacagcctgtggcggcaggggctgatgaataccgtttccgaacgg
ctcgtcgcctga

DBGET integrated database retrieval system