KEGG   Sphingosinicella microcystinivorans: SmB9_25760Help
Entry
SmB9_25760        CDS       T05811                                 

Gene name
trpG
Definition
(GenBank) aminodeoxychorismate/anthranilate synthase component II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
smic  Sphingosinicella microcystinivorans
Pathway
smic00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smic01100  Metabolic pathways
smic01110  Biosynthesis of secondary metabolites
smic01130  Biosynthesis of antibiotics
smic01230  Biosynthesis of amino acids
smic02024  Quorum sensing
Module
smic_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smic00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SmB9_25760 (trpG)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    SmB9_25760 (trpG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SmB9_25760 (trpG)
Enzymes [BR:smic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     SmB9_25760 (trpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: BBE34918
LinkDB All DBs
Position
complement(2731118..2731711)
Genome map
AA seq 197 aa AA seqDB search
MILVIDNYDSFTWNLVHYLMELGAEVEVVRNDAISAGQALSSGASAFLISPGPCTPNEAG
ISLDMVAACADAGKPLLGVCLGHQAIGQHFGGKVVRGHLMHGKTSPVSHDGTGLFAGIPS
PFTATRYHSLIVEDIPPSLIVNAWSDDEAVMGFRHAHLPIHSVQFHPESIATEHGHDMLA
NFMRIAGLTPRPRELAA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgtcatcgacaattacgacagcttcacctggaacctcgtccactacctgatg
gagctgggcgcggaggtggaggtggtgcgcaacgatgcgatttccgccgggcaggcactt
tcgagcggcgcgagcgcgtttctgatttcgcccggcccctgcacgcccaatgaagccggc
atcagcctcgacatggtcgcggcgtgtgcggacgcggggaagccgctgctcggcgtctgt
ctcggccatcaggcgatcgggcagcatttcggcggcaaagtggtgcgcggccacctgatg
cacggcaagacatcgcccgtgagccacgacggcaccgggcttttcgcgggcatcccctca
cccttcaccgcgacgcgctatcattcgctgatcgtggaggacattcccccaagcctgatc
gtaaacgcatggtcggacgatgaagccgtgatgggcttccgccatgcacacctgccgatc
cacagcgtgcagttccaccccgaaagcatcgcgaccgagcatggccacgacatgctcgcc
aacttcatgcggatcgcgggactgacgccgcgaccgcgcgaactcgccgcgtga

DBGET integrated database retrieval system