KEGG   Sphingosinicella microcystinivorans: SmB9_35100Help
Entry
SmB9_35100        CDS       T05811                                 

Gene name
glnE
Definition
(GenBank) glutamate-ammonia-ligase adenylyltransferase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
smic  Sphingosinicella microcystinivorans
Brite
KEGG Orthology (KO) [BR:smic00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SmB9_35100 (glnE)
Enzymes [BR:smic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     SmB9_35100 (glnE)
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     SmB9_35100 (glnE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase
Motif
Other DBs
NCBI-ProteinID: BBE35852
LinkDB All DBs
Position
complement(3728916..3731681)
Genome map
AA seq 921 aa AA seqDB search
MAETTPALPAELARILTEAGVSGAPEGVDACARAWAHSPYLRGLMRREDEVLLRYLAEGP
EPLMETALALLAGPDADGAAMREAKRIAAIAIALADISGRWPLEKVTAALSDLADCAIDR
AIRIAVDERMPGAGPEGFTAIALGKLGSRELNYSSDVDLILLYDRDRLAVREGDDPDNTA
VRIARRMVELMQTRDSGGYVFRVDLRLRPASEVTPIAMPIRGAETYYQSEALAWERAAFI
RARAVGGDVKMGEDFLAAIEPFVWRRSLDYTAVRDIQDMSLMIRDHYDERQEVGPGYCLK
RGRGGIREVEFFAQIHQLIFGGRDWTLRQPATLDALAALVAAERIKPDEAETLASAYRVL
RTSEHRLQMLEDAQTHQIPTRAPERKDLAALAGYRDWAAMEREIKRHAAAVGRIYDALIA
EAEVDRLPRQPAQLKAALKKAGIGPHADLADLIARWRDRSYRALRSDAAQRELESALPGL
IKAFAEAGTGRDALLRFDDFLGALPSSIQFFALIEANPRVALLLARVLELAPVLAGKLAR
RPEIVDIMLSNEAFAPLPCAEDLTDMLRARLRRHDALELKLDEVRRFVAERRFQLGVQII
EGGADPIRVGRDHAKLADAAIAVLADAVLAEFAETHGRVPDGRLLVLGFGRYGGAILTEK
SDLDLVFLFSGHHEAMSDGAKALPATTWFNRLGQRLTGALTVSTAAGPLFEVDTRLRPSG
QQGLLAVNIDTFARYQLEEAWSWEHMALTRARVVYGTEEDRAAVSAGIKAALTKPRDTER
FKAEVLEMRGDMAKARRDGGLWDVKHAPGGLIDLEFIVHFLQLSRREGLDPDLGAATAHF
VKAGAFSEDVLGAHDLMTRLLVVLRLIEGDEPPKQPAAAKAMMAAATGMADFDALKAALE
DAKRAVLSAWEAVFEVKRKAR
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
ttggcggagacaacgccagcgctgccggccgaactagcacgtatactcactgaagccggc
gtttccggcgcccctgagggtgtggatgcctgcgcccgcgcgtgggcgcactcaccctat
ctccggggcctcatgcgccgggaagacgaggtgctgctgcgttacctcgccgagggtccc
gagccgctgatggaaacggcgctggcgctgcttgccggccctgatgcagacggtgccgcg
atgcgcgaggcaaagcgtatcgccgccatcgccattgcgctcgctgacatctcgggccgc
tggccgcttgaaaaggtgactgcggcgctctccgatcttgcagactgcgccatcgaccgc
gcgatccgcatcgccgtcgacgagcgtatgcccggcgcaggaccggaaggcttcaccgcc
atcgcactcggcaagctcggcagccgcgagctcaactattcgagcgatgtcgacctgatc
ctgctctacgaccgcgatcggctcgccgtgcgcgagggcgacgatccggacaacaccgcc
gtccgcatcgcccgccgcatggtcgagctgatgcagacgcgggattcgggcggctatgtg
ttccgcgtcgatcttcggttgcggccggcctccgaagtgacgccgatcgccatgccgatc
cggggtgcggagacctattaccagtccgaagcgctggcttgggaacgcgccgcgttcatc
cgtgcgcgcgcggtcggcggcgacgtgaagatgggcgaggatttccttgccgcgatcgaa
ccgttcgtctggcgccgctcgctcgactacacggcggtgcgcgacattcaggacatgtcg
ctgatgatccgcgaccactacgacgagcggcaggaggtcggccccggctattgcctgaag
cgcgggcgcggcggcatccgcgaggtggagttcttcgcgcagatacatcagttgatcttc
ggcggccgcgactggacgctgcgtcagcccgcgacgcttgacgcgctcgcggcgctggtc
gcggcggagcggataaagcccgatgaggcggagacgcttgcgagcgcttaccgcgtgctg
cgcacgtcggaacaccgcctgcagatgctggaggacgcgcagacgcatcagattccgacg
cgcgccccggaacgcaaggatctggcggcacttgccggctaccgcgactgggcggccatg
gagcgcgagatcaagcgccacgccgccgccgtcggtcgcatctacgacgcgctcatcgcc
gaagcggaagtggaccggttgccgcgccagcccgcgcagctcaaggccgcgctcaagaaa
gccgggatcggtccgcacgccgacctcgccgacctcatcgcccgctggcgcgaccgcagc
taccgcgcgcttcgcagcgatgcggcgcagcgcgagcttgaaagtgcgctccccggtctc
atcaaggccttcgcggaagcgggaaccgggcgcgatgcgctgctgcgtttcgacgacttc
ctcggcgcgctgccctcctcgatccagttcttcgcgctcatcgaggcgaacccccgcgtc
gcgctgctgctcgcgcgcgttcttgaactggcgccggtgctcgcgggcaagctcgcacgg
cggccggagatcgtcgacatcatgctgtcgaacgaggcgttcgcgccgctgccgtgtgcc
gaagatcttaccgacatgctgcgcgcgcgcctgcgccgccacgatgcgctggaactcaag
ctggacgaggtacggcgcttcgtggccgaacgccgcttccagctcggcgtacagatcatc
gagggcggcgcggacccgatccgcgtcgggcgcgatcacgccaagcttgccgatgccgca
atcgccgtactcgcggatgcggtgctggccgagttcgccgaaacgcatggccgtgtcccc
gacgggcggctgctggtgctgggcttcggtcgttatggcggcgcaatcctcaccgagaag
tccgatctcgatctcgtgttcctgttcagcggtcatcacgaggcgatgtcggacggcgca
aaagcgctgcccgcgacgacgtggttcaaccggctcggccagcgcctcactggtgcactc
accgtcagcaccgccgcggggccgctgttcgaggtggatacgcgcctgcgcccctccggc
cagcagggtctgctcgcggtgaatatcgacacgttcgcgcgctatcagttggaggaagcg
tggagctgggagcacatggcgctcacccgcgcgcgcgttgtctacgggacagaggaagac
cgcgccgcggtttcggcaggcatcaaggcggcgctgacgaagccccgcgatacagagcgc
ttcaaggccgaagtgctggagatgcgcggcgacatggcaaaggcccgccgcgatggcggc
ctgtgggatgtgaaacacgcgccgggcgggctcatcgatctcgaattcatcgtgcatttc
ctccagctttcgcgccgggaaggtcttgatcccgatctcggggcggcgacggcgcatttc
gtgaaggcaggtgcgttttccgaagacgtgctcggcgcccatgacctgatgacgcgcctg
ctcgtcgttctccggttgatcgagggcgacgaaccgccgaagcaacccgcggcggcaaag
gcgatgatggcagcggcgactggcatggctgatttcgacgcattgaaagccgcgctggag
gacgccaaaagggccgttctttccgcctgggaggcggtgttcgaggtcaaacgaaaggca
cgatga

DBGET integrated database retrieval system