KEGG   Breviolum minutum: v1.2.013871.t1Help
Entry
v1.2.013871.t1    CDS       T04349                                 

Gene name
symbB.v1.2.013871.t1
Definition
(OIST) -
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
smin  Breviolum minutum
Pathway
smin00020  Citrate cycle (TCA cycle)
smin00190  Oxidative phosphorylation
smin01100  Metabolic pathways
smin01110  Biosynthesis of secondary metabolites
smin01130  Biosynthesis of antibiotics
smin01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    v1.2.013871.t1 (symbB.v1.2.013871.t1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    v1.2.013871.t1 (symbB.v1.2.013871.t1)
Enzymes [BR:smin01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     v1.2.013871.t1 (symbB.v1.2.013871.t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 Lycopene_cycl HI0933_like
Motif
LinkDB All DBs
AA seq 539 aa AA seqDB search
MFSRLRSGAVSAAKAQLRRLEHGKRSVSSSMIGGYEVFDHSYDAVVIGAGGAGLRAAAGL
VDHGLKTACITKVFPTRSHTVAAQGGINGALANMTEDDWRWHAYDTVKGADWLGDQDAIQ
HMCRLAPEVILELESFGLPFSRTPEGKIYQRAFGGQSLKFGKGGQAYRCAAAADRTGHAI
LHTLYGMALKFDCLFFVEYFAMDLIMSDDGKCLGCVAMCMEDGSIHRFGAHSTIIATGGF
GRAYQSCTSAHTCTGDGSAMASRAGLPMQDLEFVQFHPTGIFPAGCLLTEGCRGEGGILR
NSEGEPFMARYAPTAKDLASRDVVSRAMTLEIREGRGVGPNKDHIYLHLDHLPPETLAER
LPGISETAKIFAGVDVTKEPAPVLPTVHYNMGGIPTNWKTQVVRDAEDTIVPGLLAAGEA
GCASVHGANRLGANSLLDLVVFGRQAADTSAELVKPNSPPVTLPKNAGEASIARMDKIRN
SKGAIPTAELRRELQVSMQKYAPVYRNSDDLKKGKDVIVEVMKKYKDVGIKDRTMVWCG
NT seq 1748 nt NT seq  +upstreamnt  +downstreamnt
gaaaggccacgagaaaccagaaacatccccgggcccggtgctgtaggttaaggcgcgatg
ttctctcggctccgctctggcgctgtgagcgctgccaaggcgcagttgagacgtttggag
cacggcaagaggtccgtcagcagctccatgattggtggctatgaagtctttgaccattcc
tacgatgcggtggtgatcggtgccggtggtgcaggtttgcgagcagctgctggcttggtg
gaccatggcttgaagactgcatgcatcaccaaggtctttcccacaagatcacacacagtg
gctgcacaaggtggcattaacggtgctttggccaatatgaccgaggatgactggcgttgg
catgcctatgataccgtaaagggtgccgattggttgggagatcaagatgccatccaacac
atgtgccgattggctccggaggtgattttggaactggagtcttttggtttgccattctcc
cgcactcccgaggggaagatctatcagcgagcctttggtgggcaaagcttgaagtttggc
aaaggtggtcaagcatatcgctgcgctgctgctgcagaccgcaccgggcatgccattttg
cacaccctctatggcatggcattgaagtttgactgcctgttctttgtcgagtactttgcc
atggacttgatcatgagtgatgatggcaagtgcttgggatgcgtggcaatgtgcatggag
gatggttcaatccatcgtttcggtgcccacagcaccatcattgccaccggcggctttgga
cgagcatatcagtcctgcacctctgcgcacacatgcacaggcgacggcagtgccatggca
tccagggccggtctgccaatgcaggacttggagttcgtacagttccaccccacaggtatc
ttccctgcgggctgcttgctgacggagggttgccgtggagaggggggtatcctccgaaac
agcgagggcgagcccttcatggcacgatatgcacccaccgccaaggatctggcttcccga
gacgtggtgagtcgtgcaatgaccctggagatccgtgagggtcgtggtgttggacccaac
aaggaccacatctaccttcacttggatcacttgccacctgagaccctggccgagcgattg
cctggtatctccgaaacggccaagatcttcgcgggcgtcgacgtcaccaaggagcctgcg
ccagtgctcccaactgtgcactacaacatgggtggtatcccaaccaactggaagactcag
gtcgtcagggatgcagaggacaccatcgtccctggactgttggctgccggagaggccggt
tgcgcctcagtgcacggtgccaaccgattgggcgccaattccttgttggacttggtggtc
ttcggacgtcaagcggccgacaccagcgccgagctcgtcaagcccaacagccctccagtc
actctgcccaagaatgcaggtgaggccagcattgctcgcatggacaagatccgaaactcc
aagggcgctatccccactgcggagctcagaagggagttgcaggtcagcatgcagaagtat
gcgccagtgtaccgaaattccgatgacctcaagaagggaaaggatgtcattgtggaggtc
atgaagaagtacaaggacgtgggtatcaaggatcgcaccatggtgtggtgcgggtgaccc
agggaggccacgaaacctgatgaagtcaagttttcgtgttttttttgcaagaaagtgaga
tgttttat

DBGET integrated database retrieval system