KEGG   Breviolum minutum: v1.2.018403.t3Help
Entry
v1.2.018403.t3    CDS       T04349                                 

Gene name
symbB.v1.2.018403.t3
Definition
(OIST) -
Organism
smin  Breviolum minutum
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB Epimerase GDP_Man_Dehyd AP_endonuc_2 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 NAD_binding_10 NmrA adh_short Phos_pyr_kin 2-Hacid_dh_C
Motif
LinkDB All DBs
AA seq 1140 aa AA seqDB search
MLKPLRRGQSPSRSSNPRRKRFETLLKPIHFEVQRLPQQHETLTASVPSVELALGGKGAN
QAVAAKRLGAAVRFVGRLGRDGHGEWLQKILKTNGVDISGCTESQNLPSGQGMVMLDAEG
GASSVVVGGANTDWTTFDLTTLETTLKGASVLLLQQEIPEKINLAAAKAGKAQGVLVIQD
VGGEDRPISSDLLAVINFLCPNEGELQRLTGMPTSTRDEVLAAAETLVEKGPSVLVTLGE
RGAMLVTTAETIEVDPFPVPRVVDGTAAGDAFRAALAVALAEKQVSDLSCDFTKSLNSTT
CRQTLREALRLASAAGALAVSRQGAEPSLPWRKDCAALLSGASVASVMATEAEVFSSNQG
SCKRSKDLAFASRLNSMKERLDLWDGPIDTLGLIARQGQVQGLGMVYLNFPQHLEGRNAS
EVLSALETAGLKAGGIALRFPEDRMSLGALTNPSIEVRREAVELTKDACHWATSLGANEV
VVWPQTDGYDYQLQVDYISAWSLAVEAFREVLDSSACRDKKVSLEFKATDEISRFAIVPS
TGAALLFVREVDRENFGLTLDVGHLLMAGENPAQSVAMAGAAGKLFGIHLNDGHSRLGAE
DGLAFASVHGTGSLELVLWLQRLGYEGRIYFDTFPKNEDPVKEAELNIRRFLKLWEKAEK
MDEKLKKLSVASMFWQERPTLPSRIKVEPVRKAAARKAVAKPTPKTGLRRPGGASPRREV
PAREGALYVHSREPLLGDPMVAIRVIEAVEQRVICRALCSGRITEVKASNLQPLDVRPLR
ASSSIAALTAFEELFFVGDPEELTQEQSSFGIVQLGQLSAQKLSDYLVDSYQLLGFVPGT
RHAMGWLPWLAISSALGFESLQFPEEAALAHGKTALVTGAAGFIGSHVARHCRDLGMTVL
ALDDLSGGFAANVPQGVTFIEGDIRDAELLDGIFRQYEVQYVYHLAAYAAEGLSHFIRSY
NYRTNLVGSVEILNQAIKHHVHCFVFTSSIAVYGSINDLSQMQNPNRLKEEDRPTPEDPY
GIAKYAFELDLHAAKELFGIDFVIFRPHNVYGPHQNMFDKYRNVVGIFINQIFHGQPMTI
FGNGEQVRAFSYIDDVAPIIARGPLNLRARNEIFNVGADVPYTVNEWQSPITTRSKITLL
NT seq 3738 nt NT seq  +upstreamnt  +downstreamnt
tacctacagattttgctagatatcttcacagaatgaaaaggtgagtcggtgaatgatgag
atgtttttttttcgttgggagttgagaggtcccagatgctgaaacctcttcggagaggac
agtcaccaagccggtcttccaaccccaggaggaaacgttttgaaacattgctgaaaccaa
tccatttcgaggtgcaacgcctgccccagcagcatgagaccttaacagcttcagtgccca
gtgtggagctggccttgggaggcaaaggtgccaaccaggctgtggcagcgaagcgcttgg
gtgctgcggtgcgttttgtaggacgtctcggccgagatggccatggtgaatggttgcaga
agatcttgaaaaccaatggcgtggacatctctggctgcacagaatcccagaatttgccat
cagggcaagggatggtcatgttggatgcggagggtggagcctcttcagtggtggtgggcg
gagccaacaccgattggaccacttttgacttgaccacgttggaaacaactttgaaaggtg
catctgtcttattgcttcagcaggaaatcccggagaagatcaatttagcagctgccaagg
ctgggaaagctcaaggtgtgcttgtgatccaagatgttggtggagaggatcggccaattt
catccgacttgctggcagtcatcaacttcttgtgtcccaacgagggggagctgcagcgct
tgactgggatgcccacaagcaccagggatgaagttcttgcagcagctgagaccttggtag
agaagggcccttcagtgcttgtgaccctgggtgagcgtggtgccatgttggtgaccacag
cagagaccattgaggttgatcccttcccagtgccacgtgtggtggatgggactgcggcag
gagatgcgttccgtgcggccttagcagtagccttggcagagaaacaggtttcagaccttt
cctgcgatttcaccaaatccctcaactccacaacttgccgacagacactacgggaagcct
tgcgtttggccagtgcagctggggccctggcagtatcacgacagggtgctgagcccagct
tgccatggcgaaaggactgtgctgccctactgtcaggtgcttcagtggccagtgtgatgg
ccactgaggcagaggtcttttcctcgaatcagggcagctgcaagagatcaaaagatttgg
cctttgcctcgcgcctgaattcgatgaaggaaaggctggacttgtgggatggccccatcg
acaccctgggcctcattgcacgtcagggccaagtccaaggattgggaatggtctacttga
actttccgcagcatctggaagggcgaaatgcctcagaagtgctgagtgctctagagactg
ctggcttgaaggctggcggcattgctttgcgctttccagaagatcggatgagtttgggag
ctctgacaaatccatccatagaggtgaggcgagaggcagttgaactgacgaaggatgctt
gtcattgggccacttccttaggtgccaatgaggtggtagtttggccgcaaacggatggtt
atgattaccagctgcaagtcgactacatttctgcttggtcactcgcagttgaagcttttc
gtgaagtgctagatagctcggcctgtcgcgacaaaaaagtgtccctggagttcaaagcta
cggacgagatcagccgctttgccatcgttcccagcaccggtgccgcattgctcttcgtgc
gcgaggtcgaccgtgagaattttgggttgacattggatgtgggccacttgctgatggcag
gtgagaacccagcacaatccgtagcaatggcaggtgctgcaggaaagctctttggcatcc
acttgaatgatggtcattcacgtttgggtgcagaagacggtttagcctttgcatcagttc
atgggactggatctttggagttggtcttgtggctacaacgactgggctatgaaggacgca
tctactttgataccttcccaaagaatgaggatcctgtgaaggaagctgaactgaatatcc
gtcgcttcttgaaactctgggaaaaagcagagaaaatggatgagaagttaaagaagctat
cagttgcttccatgttttggcaggagcgacctactctccccagtcgaataaaggtggaac
ctgtaaggaaagcagcagccaggaaagccgtggcaaagcctacgcccaagactggccttc
gacgacccggtggagcttccccgagacgagaggtcccggcccgagaaggggccctttacg
tccattcgcgggaacctttgctgggtgatccgatggttgccattcgcgttatcgaagctg
tcgaacagcgggtgatttgtagagccctgtgtagtggtcgcatcactgaggtgaaagcat
ccaacttgcaacccttggatgtgcgccccttgcgggcctcaagcagcattgccgcactga
cggcctttgaggaactgttctttgtgggagatccagaggagttgacccaggagcaaagca
gctttggtattgttcaactgggacagctctcagcgcaaaagctttcggactacctggtgg
attcctaccaactgcttggctttgtgcctggcacacgtcatgctatgggatggctgccat
ggttggcgatttcttcagctttgggctttgaaagcctgcagtttcccgaggaagccgcct
tggcacatggcaagaccgctttagtgacgggtgctgctggatttattggcagccatgtag
ccaggcattgccgtgatttggggatgactgtcctggcgctggatgacttgtcagggggct
ttgctgccaatgtgccgcaaggggtgaccttcattgaaggcgacatccgggatgcagagc
tgttggatggaatctttcgacagtatgaggtgcagtacgtctaccatcttgcagcttatg
cggctgaaggtctttctcatttcatccgctcctacaactatcgaaccaatctcgtcggat
cagtggaaattttgaatcaagcaatcaagcatcacgttcattgcttcgtgttcacatctt
ccattgccgtctacggcagcatcaatgatctgtcgcagatgcaaaatcccaatcgtctga
aggaggaggatcgtcctaccccagaagatccatatggcattgcgaaatatgcctttgaac
tggatttacatgcggccaaagagctatttggcatcgatttcgtgatatttcgtccacaca
atgtctacggaccccaccagaacatgttcgacaagtaccgcaatgttgttggtatcttca
tcaatcagatcttccatgggcagcccatgaccatatttgggaatggcgaacaggtccgtg
ccttcagttatatcgatgatgtggcacccattattgcaaggggacccttgaatttgcgag
cacgaaacgagatcttcaatgtgggggcagatgtgccttacactgtaaatgagtggcagt
ctccaatcacgacaaggtcaaagattactttgctgtgaggtccaccattggtctcaaaga
gggactgggcaggactgtcagttggtatcaagctcaagggcacctcttcaaacctgtgga
gtttgaatccgtagaggtcattgatcgtttgccacccgcctggcatcgcaaagacttgga
ggagagtgccgtgtgccgcggcagccgtgtatcaactcaaagagaagagctgtagtccaa
aaaagcagcaaacaaccg

DBGET integrated database retrieval system