KEGG   Symbiodinium minutum: v1.2.021811.t1Help
Entry
v1.2.021811.t1    CDS       T04349                                 

Gene name
symbB.v1.2.021811.t1
Definition
(OIST) -
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
smin  Symbiodinium minutum
Pathway
smin00500  Starch and sucrose metabolism
smin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    v1.2.021811.t1 (symbB.v1.2.021811.t1)
Enzymes [BR:smin01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     v1.2.021811.t1 (symbB.v1.2.021811.t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 SnoaL_2
Motif
LinkDB All DBs
AA seq 161 aa AA seqDB search
MPGFTDNYVANTVKELSKVFCGSYPVNRQDSDEGVPGVLLGRYERDRYGHLSQGNPWVLI
TASLANLFYQAAAEVKKGKVADAKVWAKVFKNGGNFTGSAEDFVAAGDSVLVRIKHHMNE
GMHLFEQIDKHTGKQYNAEDLTWSYSEVLDALHQRREALKA
NT seq 1373 nt NT seq  +upstreamnt  +downstreamnt
tcgcttcaaaaactgtgaatcgcttcaaaaaaagcagtgttttccccagctggtttcccc
ctgacggatttcatccaggagagatgtggagaagagcatcgatgcctttgcaacgtgggt
ctcgcgttcccacgaacgtacccaacccgctgggaatgtacaggtcagcgatgccgccga
ggaagcgtttttggagcccaaatggacctttgacggagaaccttacaaaggtggatggtg
tcgtccacaaactgatggaccagccttgcgtgcccgtttgatgatgcgcgcagccaagat
ctttccggacttggcgccaaagttgattgacttggcgaagaaggacctggagtggctggt
gctgaatcatcgtatcgagagctgtgatttgtgggaggagacccgagataaagacttctt
atggaatcgagtggtgcaattggctgccctagcagaaggacatcatttggacctggaagt
ttggcaaaaagaaaaggtcttggccgcgatccacgagaagggtgccaccttgacgaatca
ccttgcaggggctgcaggtgaggaatacctcaccaactgccctgcaacgcaacagtctga
tgattgcgtcaggtataacaagaccttggatggtgtattgattttgacccttatccatgg
gcatcctgtggtggaaacagatctctttcaaatgccaggattcactgataattatgtcgc
gaacaccgtgaaagagctcagcaaagtgttttgtggctcatatccagtgaatcgacaaga
cagcgacgagggcgtgccgggcgttttgctagggcgctatgaaagggacagatatggcca
tttaagtcaaggcaatccctgggtgctgatcactgcctctttggccaatctcttttatca
ggcagccgcagaggtgaagaaaggcaaggtcgctgatgcgaaagtgtgggccaaggtctt
caagaacggaggcaatttcactggctcagcagaagactttgtggctgcaggggattccgt
cttggtgcgtatcaagcatcacatgaatgaagggatgcacctttttgaacagattgacaa
gcacacaggcaaacagtacaacgcggaggacctcacctggagctacagtgaagtcctgga
tgccttacatcaacgacgtgaagccttgaaagcttaaccgccgtacaacagctgcggcgt
gattgcctctgattcggcaccagctgttaaggggatgatggaccatggatgatggatgat
ggatgggtgggtagatgagttggaaggatgtggaagtgaggccgtctcaaaattgagcgc
catcactgactgccgtgccttgtgcctcttgacaaaaaaggatgctttttcat

DBGET integrated database retrieval system