KEGG   Breviolum minutum: v1.2.025734.t1Help
Entry
v1.2.025734.t1    CDS       T04349                                 

Gene name
symbB.v1.2.025734.t1
Definition
(OIST) -
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
smin  Breviolum minutum
Brite
KEGG Orthology (KO) [BR:smin00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:smin01001]
    v1.2.025734.t1 (symbB.v1.2.025734.t1)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:smin03019]
    v1.2.025734.t1 (symbB.v1.2.025734.t1)
   03036 Chromosome and associated proteins [BR:smin03036]
    v1.2.025734.t1 (symbB.v1.2.025734.t1)
Enzymes [BR:smin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     v1.2.025734.t1 (symbB.v1.2.025734.t1)
Protein kinases [BR:smin01001]
 Serine/threonine kinases: AGC group
  PKA family
   v1.2.025734.t1 (symbB.v1.2.025734.t1)
Messenger RNA biogenesis [BR:smin03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     v1.2.025734.t1 (symbB.v1.2.025734.t1)
Chromosome and associated proteins [BR:smin03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    v1.2.025734.t1 (symbB.v1.2.025734.t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Aldo_ket_red Pkinase_Tyr Haspin_kinase Kinase-like Pkinase_C YrbL-PhoP_reg
Motif
LinkDB All DBs
AA seq 666 aa AA seqDB search
MALKVPIVKLLDGTSMPILGFGCYKVGVIPGSATGAAGAAKPAPAEQVIGDALAAGYRCF
DCAQFYENEEVVGQAFQAAGIPRSELYITSKVWTNRIFEGPAAVREQCLKTMKDLRCEYL
DLYMIHWPVPVKHVEAYKELVKLQEEGKVKSIGVSNYTVEDLTDLEAAGLPLPTVNQIEI
NPFLYRKKTIAHFEAKGIRFQAYRALCNFGKAASLESEVVAGLAAKHSRSPSQILGRWCV
QKGFQHIPKSEKRSRMDENAQIFDFSLDAEDMEKLENLTTEASLATFKSSYQKGVLRDTP
LEAHPESAKSDITLETGPAWSRLPPDFEKYWGWLAGADEKTMTEKEMDLSGEKLTVGDFS
LGKTLGTGAFGRVRFVTHKGNGRHYALKTLKKAAIIKMKQVDHIMSEKQILAKLQHPFIV
NMFGSFHDPRYIYMVLEYIVGGEFFTHLRKAGRFENEQSLFYAAQITCIFEYCHELNIVY
RDLKPENILINADGYVKLTDFGFAKVIEHRTYTLCGTPEYIAPEVLLNKGHGKPVDWWTL
GILVYEMIVGYPPFVDEDPMGIYQKILAGKITFPKIFHKEAKSLVKKLLTPDLGKRFGNL
KNGAADIKEHKWFKDLSWDDLVAKKIEAPFKPAVKGATDTSNFDDYPDSDQEPPAVNASQ
DPFTNW
NT seq 2797 nt NT seq  +upstreamnt  +downstreamnt
ctgtcagcaatttttgtcgcattgccatggcattgaaggtgcccatcgtgaaacttctgg
atggcacttcgatgcccatcctgggttttgggtgctacaaagtgggcgtgatccctggct
ccgccaccggtgcggctggcgccgccaagccggcacccgcagagcaggtcattggtgatg
ctttagctgcggggtatcgttgcttcgactgcgcccagttttatgagaacgaggaagtcg
tggggcaagcatttcaggctgctggcattccgagatctgaactctacataacttccaagg
tatggacgaatcgaattttcgagggccctgcagctgtccgagagcagtgtctgaagacga
tgaaggacttgcgttgcgagtatttggatttgtacatgattcactggccagtaccagtga
aacatgtagaggcctacaaggagctcgtgaaattgcaagaggagggcaaggtgaagtcca
ttggtgtttccaactacacggtggaggacttaacagacctggaagccgctggccttccat
tgcccacagtaaatcagattgagatcaatccctttctctaccgaaagaagaccattgcgc
attttgaggccaagggtatccgatttcaggcctatcgtgccttgtgcaacttcggaaaag
cggcctccctcgagagtgaggtggtggcgggactggctgccaagcacagccgcagtccat
ctcagatcctgggaagatggtgtgtgcaaaaaggcttccagcacattcccaagagtgaaa
aacgatccaggatggatgagaatgcgcagatttttgacttttccctggatgctgaggaca
tggagaagttggagaacctcaccacggaagcttctctggcaaccttcaagtcctcctatc
agaagggtgtccttcgcgatacacctctggaggcgcatccggagtccgcgaagtccgaca
tcaccctggaaactggcccagcttggtccagattgccccctgacttcgaaaaatactggg
ggtggttagcaggggcagacgagaaaaccatgacggagaaggaaatggatctgtcagggg
aaaagcttactgtgggcgacttcagtctcggcaagacgcttggcactggagcgtttggac
gtgtcaggttcgtgacgcacaagggtaatggaagacactacgccttgaagaccctaaaaa
aggctgccatcatcaagatgaagcaggtggatcacatcatgagcgaaaagcagatcttgg
ccaagttgcaacaccctttcattgtcaacatgtttggctccttccatgatccccgctata
tctacatggttttggagtacattgttggtggcgagttctttactcatttgcggaaggccg
gccgctttgaaaacgagcagtctctcttctatgcagcgcagatcacctgcattttcgagt
actgtcatgaactgaacattgtgtaccgtgacctgaaacctgagaacatcttgatcaatg
cagatggctacgtgaagctcaccgactttggctttgccaaagtcatagagcatcgcacgt
acaccttgtgtgggactccggagtacattgctccggaagtcttgctgaacaaggggcatg
gcaagcccgtagactggtggacgctaggcattctcgtgtatgagatgatcgttggttatc
cacctttcgtcgatgaggatccgatgggaatctatcagaagatcctggccggcaagatca
ccttcccgaagatttttcacaaggaggcaaaaagcttggtgaaaaagctgctcactcccg
atctgggcaagcgattcggcaacttgaagaatggcgcagcagacattaaggaacacaaat
ggttcaaggacctgagctgggatgatttggtggccaagaaaatcgaagccccgttcaagc
ccgcggtgaagggtgcgacggatacaagcaactttgacgactatccagattcagaccagg
aacctcctgccgtcaatgcgtcgcaggatcctttcaccaactggtgatctgaattgggaa
ttgcattggaacgccacaacttagcactcaaagggtgagcaagttgttgtatatgcgaat
gatgttgaacagggcaggatgggcaggtcgaaacacaaagtacaactgctaaatccccag
ctttccccccaaaagagcctacaaccatattatcttgaggggtttttcaatagctgggga
gcaatctcaagcatgaaatcaacaggtcgacaataagatacaaagcaactggcaattcaa
aggtgaccttttttgaccccacttggaggtcaatggtttgccacaagggtcagcacagcc
ccgaaaaggtcataattgaattgccaggggagaaaattccgatggcccgtgcctgttcac
aatacaaagtggtgctctcaaacgatgccactgtttcagtagaacgcaaaatggatcgct
cggcgtgtccgttgtaaatgagatctttggtgccaaatttgatccgaagaccaaaccggt
ctttggtggaaaacaactcttctgttttgattctaaacatccattgataaaaatgtcatg
tttctatgatccgatgtggctcacaaaaaattagcaacatttgtgaccaaacctctgttt
tggacggccgaatgcaacccgcagaatgcccgggaccattaggatccgagctcccttgcg
ccacgctgtcgcatcagcagaggtccgtttcacgaagcgctgcacatgtgattgtactga
gattcccaaaacgcggcaaatcggcaaaagcagcgga

DBGET integrated database retrieval system