KEGG   Symbiodinium minutum: v1.2.030829.t1Help
Entry
v1.2.030829.t1    CDS       T04349                                 

Gene name
symbB.v1.2.030829.t1
Definition
(OIST) -
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
smin  Symbiodinium minutum
Pathway
smin00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:smin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    v1.2.030829.t1 (symbB.v1.2.030829.t1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smin02000]
    v1.2.030829.t1 (symbB.v1.2.030829.t1)
Enzymes [BR:smin01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     v1.2.030829.t1 (symbB.v1.2.030829.t1)
Transporters [BR:smin02000]
 Other Transporters
  Pores ion channels [TC:1]
   v1.2.030829.t1 (symbB.v1.2.030829.t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 Pep_deformylase GST_C_2 GST_C_5 GST_N GST_C GST_C_3 Glutaredoxin
Motif
LinkDB All DBs
AA seq 889 aa AA seqDB search
MGRSTATVWAVAAVLTLRQTFVAPQLGGVARRPRMARRFFGMGAAPAASAVSDTAPSWEQ
LKAMLHADASDELKEFRRNLGRGQVANAMAKLRIFDKDEEAAQKVTLYRDSASWCPYCHK
VWMLLEEKQIPYKVEKVNMACYGEKPPDFLALQPNGQIPVAVIDGAVLRSSDAIIDRILQ
MPGASPEIDQELDPFDHPQSTNLLRLERMLFSTWLGWLCRGGGRSDFERTLRKVEDTLTE
NGGPFFLGERFSLVDIMYTPFIERAVASLAYFKGYNIREKLAFPSINRWFDAMETRSSYR
ATKSDYYTHAHDLPPQLGGCQAESGGEAIRRAIDGGDWQLPLSDSVEPEWSWISPREARL
EAAERMIHNHEAIARFAARAKSGPGFPPAWAELADPNAKAAEKWIPIVDIFLRHTVHLLM
AGDAAAADRDESTAERAAAWALAKESLSSLKGEDRDDLAECLRYLQKRVGVPRDMSLNAA
KRLRPEDRSKKHVSTPSGQSASVPGYEAVVGRALEVDVEAFNEEGRSVSFSAKGWQARQL
QHTVDMLEGVLYVDRMETRSFRRDSIEEDLPEGIPYGVKAKAKVLARSGLKTQIFLKKRI
RDSRLEMFYFQVLVVSSLWTPFCLMQIWCACFFLISTVESKLVNCGVCKDVPDSSCRWCQ
TTRSAMNKAADTSRSEGNCASRSLVNCGVCSCVTPRSCAFCSGDGHAAPIVTKPELVVSE
AARLFGHMNLMVILVVQWIQNWLWPAQASVGEAQGSPPWAREGRSFASSVAFTAAMAVEK
EATELQLDLSDEEFQMLDPEILNVMSKVEAALEAKKRRREAEVDRLEQQDVLRSAKHRKM
LAHWESQFQRAALLAAVVPLGPKTEVRTSPDAAESKEVAKKKVCSKVLS
NT seq 2816 nt NT seq  +upstreamnt  +downstreamnt
tgtgtgatttcaccagccacccccccccctcggtgttttttcgataaacaccgtggaaaa
gtcgagggtcgccccgttttcccatgggtcgatctacggccacggtctgggctgttgcgg
ccgtgttgaccttgcgacagactttcgtggcaccgcagttgggaggtgttgctcgtcggc
cacgcatggctcgacgtttcttcggcatgggtgctgcacctgccgcgtctgcggtgagcg
atacggcccccagctgggaacagctgaaagccatgttgcatgctgatgccagtgacgagt
tgaaggagtttcgaaggaacttggggcgaggacaagtggcgaatgccatggcgaagcttc
gcatctttgacaaggatgaggaggcagcccaaaaagtcacgctctaccgcgattccgcat
catggtgtccatattgtcacaaggtttggatgctcctggaagagaaacaaattccctaca
aagttgaaaaggtgaatatggcgtgctatggcgaaaaaccaccagatttcttagctttgc
agcccaatggacagatccctgtggcagtcattgatggtgctgttctaaggtcctcagatg
ccattatcgatcgtattctacagatgcccggggcatcaccagagattgaccaagagttag
atccttttgatcatccacaaagcacgaacttgctgcgcctggagcgaatgctcttctcca
cctggctgggatggctgtgccgtggcggtggtcggtcggacttcgaacgcaccttgcgca
aggtcgaggatactttgaccgaaaatggtgggcccttctttcttggggagcgcttctctt
tggtggacattatgtacacgcctttcatcgagagggcggtagcatctttggcttacttca
agggctacaacatccgagaaaagttagccttccccagcatcaaccgatggtttgatgcta
tggagacgcgaagcagctacagagccacgaagtctgactattacacccatgctcatgact
taccaccacaattgggtggttgccaagcagagtcaggtggtgaagccatccgccgtgcca
ttgatggtggtgactggcagttgcccttgtcggactcggtagaacccgagtggtcttgga
tttcgccgcgggaagcacgactggaggcggccgaacgcatgattcacaaccatgaggcca
ttgcacgctttgcagcacgtgcgaagagtggtcctggttttccaccggcttgggccgagc
ttgcagatcccaacgcaaaagctgctgagaaatggattcccattgtggacattttcctgc
gccataccgtgcatttgctgatggcgggcgatgctgctgccgcagatcgcgatgaaagta
cggcagaacgcgctgctgcttgggccttggcgaaggaatccttgtcctccttgaaaggag
aggatcgcgatgatttggccgaatgcttgagatatttgcagaaacgagtaggtgtcccgc
gggacatgtcgctgaatgcggccaagcgcctccgtccggaagataggtccaagaagcatg
tctccacacccagtggtcagtcagccagtgtccctggatatgaggcagttgttggccgag
cacttgaggtggatgtggaagccttcaatgaagagggtcgttcagtaagcttcagtgcca
agggatggcaggcgcgtcaactgcaacatacggtagacatgttggagggtgttctctatg
tggatcgaatggagacacgctccttccgacgcgacagcatcgaggaagatctgcctgaag
gaatcccctacggcgttaaagcaaaggccaaggttcttgcacgctcaggtctgaagactc
agatttttcttaaaaaaaggattcgagactcgagactcgagatgttctattttcaagttt
tggtggtttcaagtctgtggacaccattttgcctcatgcagatttggtgtgcatgttttt
ttctcatttccaccgtggaatcaaagctggtgaattgtggcgtttgcaaagatgtgccag
actccagctgtcgttggtgtcagacaactcgatctgcaatgaacaaggcagcagacacct
ctcgaagcgaaggaaattgtgcttccagaagcttggtgaattgcggtgtgtgcagctgcg
ttacgccacgttcttgtgccttctgtagtggagatggccatgcggcacctatcgtaacca
aacctgagctggtcgtctcggaagccgcgaggctttttggacacatgaatttgatggtaa
ttttggtggtgcaatggattcaaaattggctttggccagcgcaagcgtcggtaggcgaag
ctcaaggttcaccaccctgggctcgggaaggacgcagtttcgcgtcctccgtggcgttta
cagccgccatggctgtggaaaaggaggcaacagagttgcaacttgatcttagcgatgagg
agttccaaatgttggatccggagatcctgaacgtcatgtccaaggttgaggcagccttag
aggctaagaaaagacgccgggaggcggaggttgatcgtttagagcaacaagatgtcttgc
gcagtgcgaaacatcgtaagatgttggcccactgggaatcgcagtttcaacgagcagccc
tgctggcagctgtagtccccttagggcctaagactgaggtgagaacttcgccagatgcag
cagagtccaaagaagttgcaaaaaaaaaggtatgcagtaaagttcttagctaggtggtgg
tttcaattccttttttcatgttcatccctacctgggaaaaaacgatccaatttgac

DBGET integrated database retrieval system