KEGG   Breviolum minutum: v1.2.035047.t1Help
Entry
v1.2.035047.t1    CDS       T04349                                 

Gene name
symbB.v1.2.035047.t1
Definition
(OIST) -
  KO
K15276  solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2
Organism
smin  Breviolum minutum
Brite
KEGG Orthology (KO) [BR:smin00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smin02000]
    v1.2.035047.t1 (symbB.v1.2.035047.t1)
Transporters [BR:smin02000]
 Solute Carrier Family (SLC)
  SLC35: Nucleoside-sugar transporter
   v1.2.035047.t1 (symbB.v1.2.035047.t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfotransfer_4 UAA Sulfotransfer_3
Motif
LinkDB All DBs
AA seq 677 aa AA seqDB search
MTASEPLPLRFKRQGGPNEVEVICVGLMRTGLQSLHRAFSTLGYTEIYDQERISHSYELW
NDVLQNRDPTKAFKTMFGGCQIVMGMPTFCFWEDIWKLYPNAKIILTVRDEDGWWRSVSK
AKIAMDHDVPGAPLRYGTIRRQLERWLVPSYHKFCEVLRFAWATTLGATGLQMDMLNEST
TRNSYRQHNSYVKSLLDGKTTNGKPQLLVFDVREGWEPLCKFLEKDVPDRTFPKQEDLTG
LYFPDGQQRPEWLDRVTGFDELFAPDTAFGTKMRQELLRGLMFGTAALTILVLIVLTAVV
LLTDLPVTIIVLIYLALIIVGWDAYVVMHMLVLRVPLLMVVPLALQSLLIAAALHACFIS
YGIFKEKLVTQDKVASVVLVLSSRAMSVICSAVALLVTQKSLRLGAPLWSMSAFAFTNEL
STFAGYEMLKYVSFPVQVMAKSVKMLPNMMMGRIVNGTRYSFFQYGQAIAALICVAIMHV
SDEAAHGEKGSPSDAMSENWKLFMGVVMLLVFFAGDSFTSQWQTNLYSKYPHLTQLQMML
GGNFLGMVFTSSNLYYSWPKIRASIQLATENPEVLQRIVALGVVSALGQFCIYSAIRILG
SLSFTWIMTARQLLSVLISLIFFGHGFSFVKLLCILTVFAIMSWKQLSKIPEKIKERKQR
RLQMSKTLSTLPDLKTE
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
tagtgtgccaccttgcgccttggaatcggcttgtgtcatgacggccagtgaaccgttgcc
cctgagatttaaacgacaaggtggtcccaatgaagttgaagtcatttgcgttggactcat
gcgtactggattgcaatcattgcaccgggcattttcaaccctcggatatactgagattta
cgatcaggagagaatctctcacagctacgagttgtggaatgatgtgctgcagaatcgtga
tccaaccaaagctttcaagaccatgtttggtgggtgccagatagtgatgggtatgccaac
cttttgcttttgggaagacatctggaagttgtatcccaatgcaaagatcattttgacggt
ccgggatgaagatggttggtggcgctccgtcagcaaggctaagatagcaatggaccatga
tgtgccaggtgcgccgttgcgatatggtaccatcaggcgtcagttggaaaggtggctggt
gccgtcatatcacaaattctgtgaagttcttcgctttgcttgggccacgacccttggggc
cacagggctacagatggatatgttgaatgagtccactacacgaaatagctatcggcaaca
caattcttatgtgaaatctttgctggatggaaagacgacgaatggaaaacctcagctatt
ggtgttcgacgtgagagagggatgggaacccttatgcaaattccttgagaaagacgtacc
tgacaggaccttcccaaagcaggaagatctgacaggtttgtatttcccagatggccagca
acggcctgagtggcttgatagggtgacgggttttgatgaactctttgctccagacacagc
ttttggtaccaagatgcgacaagagcttttgcgtggactcatgttcgggacagcggctct
aaccattttggtcctgattgttcttactgctgttgtgctgctaactgatcttccagtgac
aattattgtcctcatttaccttgcactgattatcgttggatgggacgcttacgtggtgat
gcacatgctggtgctgcgcgtgccgctgttgatggtggtgccactggcactccagtcgct
tctcattgcagcagctctgcatgcttgctttatctcctatggaatcttcaaggagaaact
ggtgacacaggacaaggtggcgagtgtggttctggtgctgtcttccagagctatgtctgt
aatttgcagtgcagtcgccttgctagtgacccagaagagcctgagattgggtgcacctct
atggtctatgagtgcctttgcgttcaccaatgaactctccacttttgcgggctatgagat
gctgaaatacgtctcatttcctgtgcaagtcatggcaaagtcggtgaagatgttaccgaa
catgatgatgggacggattgtgaatggaactcgctactccttttttcaatatggccaagc
gattgctgcattaatatgtgtggccatcatgcatgtctccgacgaggcagctcacggcga
gaaaggttctccatctgatgcaatgagtgaaaactggaagctcttcatgggagtagtgat
gctgcttgtattttttgcgggtgatagttttacttctcagtggcagaccaatctctattc
taaatatcctcatttgacacaattacagatgatgttgggtggcaacttcttgggcatggt
cttcacttccagcaacttgtattatagctggccgaagattcgtgcatcgattcaattggc
cacagagaatccagaagtcttgcaacgtattgtggctttgggtgtggtctcagctcttgg
tcaattctgtatttattcggccatcagaattctgggctcgttgtcctttacctggatcat
gaccgctcgacagctgttgtctgttttgatctctttgatcttttttggtcacggctttag
cttcgtgaaattgctctgtattcttacggtcttcgccatcatgagctggaaacaactctc
caagattccggaaaagatcaaagagaggaaacagaggcggctgcagatgtcaaagactct
gtcgactcttccagacttaaaaacagaatgagaagccaaagacatgaatcaatggcgcaa
caaaaa

DBGET integrated database retrieval system