KEGG   Breviolum minutum: v1.2.038026.t1Help
Entry
v1.2.038026.t1    CDS       T04349                                 

Gene name
symbB.v1.2.038026.t1
Definition
(OIST) -
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
smin  Breviolum minutum
Pathway
smin00562  Inositol phosphate metabolism
smin01100  Metabolic pathways
smin04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:smin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    v1.2.038026.t1 (symbB.v1.2.038026.t1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    v1.2.038026.t1 (symbB.v1.2.038026.t1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:smin01009]
    v1.2.038026.t1 (symbB.v1.2.038026.t1)
Enzymes [BR:smin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     v1.2.038026.t1 (symbB.v1.2.038026.t1)
    3.1.3.48  protein-tyrosine-phosphatase
     v1.2.038026.t1 (symbB.v1.2.038026.t1)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     v1.2.038026.t1 (symbB.v1.2.038026.t1)
Protein phosphatases and associated proteins [BR:smin01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    v1.2.038026.t1 (symbB.v1.2.038026.t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase CDKN3 DSPc Y_phosphatase3 PTPlike_phytase
Motif
LinkDB All DBs
AA seq 197 aa AA seqDB search
MGFPGRGSGACFRNPRKEVRRFLRWAHGDGCFRIYNLCVERSFRENGFEETVCFPCPDHC
PPDFAKILAFCQDVEAWLKADESNVAVIHCKAGKGRSGTMISSLLVYAGAVLSARDALFW
FGHIRGGTRAGVTIPSQIRWIAMFELWLKGNIPLLSDPMAGSHGEGGADAASQRRAPSTS
QLPSTPDARERDGRSSL
NT seq 2332 nt NT seq  +upstreamnt  +downstreamnt
tggtagattcaaagcatgttgctcaaacacggctgtgcagaaggcttttcctctgtcaag
tgaacagtgaacatgaggcatagaaaggtatccagaattcctggagtgctgagatttgat
atctgaaagaatctagtttgggaagtttcccttcatgtgtctaaatgacatagccatcat
gcagcgcagtgaacctgatgccatgaagtaggtggcgtaacgacagaaggatgccgcagt
ctggacactcagttgctcagagacattttgtcacccatgatgtccattcagctgttttca
tcatcatcgtcatcatcatcatcatcatcatcatcatcatcatcatcatcatcatcatca
tcatcagaacgatagtgtcatgatatttcatgatcattgcattcctgagggcaaacctca
atcatgctgcaccgtgtgaagtccttattgcatttgccataagagtttgagggcaaaaat
acgaaactgccgcggccatggttggagattcgtcggagatccaatcaagatacagcaaca
aaaagtcatggcaaggaaagatagatatacagagccaaagtgagcacatgaactttacaa
ggaatcatcagatttcacgcaaaagttgaggatgatgcacacttggcattggaactcctg
ttttgctacaacaaaaagcaacatgtgtttttgaatttgatctagaaacttcacttatcc
acagacccaattcttggaaaatgtttgaaagatcctttcagccttggtctgtttgggttt
ggattgtccccaccatgttgcgcttgaaccaagcgtgttccactatcgattctttagatt
ttgggacactgctgcgacttgtttgccttttgtgaaccatgcactgcgccccttactggt
gctcttgtacagaaagctatgtggacaaaggattggtgcctgaaggccatgaagatgata
agggcgatgtgattcacactgtttgggagcatccttcgccactgacacagcgtaccatgc
acacggacaaggacaaacgctccatctgtgcggccagcacccgtcgcagctctgaatctt
tgacgttgtcagcgctcttcggcagcgattggcccaagccggagatcgacagcggcaacg
aagaggcagttttgcaggagaattggttgggtaccgcaaggaagcgtggatcccaggagc
accttggagttctaagcacagggctgtgtggatggatgcggcggaaggtggcaggaagcc
gttgtcgctatgtgtcaaatggtttcgacctggatttggcctatgtcacctccagaatca
tcaccatgggtttccctggcagaggatctggcgcttgcttccggaatccacggaaagagg
tgcgccgtttcctccgttgggcccacggagatggatgctttcgcatctacaacttgtgcg
tggaacgcagctttcgcgagaatgggtttgaagagacggtttgcttcccatgtcctgacc
attgtcctccagactttgccaagatcttggctttttgtcaagatgttgaggcatggctga
aggctgacgagtccaatgtggcggtcatccattgcaaggctggtaagggccgttctggaa
ccatgatttcatcattgctagtttatgctggtgctgtcctttcggcacgagatgctctgt
tttggtttggacatatccgaggaggcacccgtgcaggtgtcaccattccctcacagattc
gttggattgccatgtttgaactctggttgaaaggaaacattccactcctcagtgatccca
tggctggaagccacggtgaaggtggtgctgatgcagcgtcacagcgaagggctccgagta
cgtcacagcttccgtcaacgcctgacgctcgagagcgggatgggcgaagttcactttgag
gggcccttgtggacggagccggaaggcttgatttgcttgacgttgtggcgtggctgttgg
cagaaactgcggatcaaggcttggtggcatcatgccttcctgcagcgcaccgatgaaacg
aggaatctcttggtccttgacttgccaaaagcgtgcgtggatggcttgcaacgtgatgcc
gcagagcatgccttgactccggcggactttcgatggaccgtgggctttgccgagatcgag
acttcggaagggaaggaaaccaaggaaatcacagaaacatgacaatttgaaaaagaggtg
aagtgaacctcaaagtacatagagattcatggtggattgccatttttagagcacttggag
gatgttgttgcagcattcttaatgttttggagaatgaaaaagattcctggat

DBGET integrated database retrieval system