KEGG   Sphingobacterium mizutaii: 4412673_00579Help
Entry
4412673_00579     CDS       T05395                                 

Gene name
lptB_1
Definition
(GenBank) Lipopolysaccharide export system ATP-binding protein LptB
  KO
K06861  lipopolysaccharide export system ATP-binding protein [EC:3.6.3.-]
Organism
smiz  Sphingobacterium mizutaii
Pathway
smiz02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:smiz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    4412673_00579 (lptB_1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smiz02000]
    4412673_00579 (lptB_1)
Enzymes [BR:smiz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     4412673_00579 (lptB_1)
Transporters [BR:smiz02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    4412673_00579 (lptB_1)
 Other transporters
  Pores ion channels [TC:1]
   4412673_00579 (lptB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 RecA AAA_23 BCA_ABC_TP_C AAA_29 SbcCD_C
Motif
Other DBs
NCBI-ProteinID: SNV41991
LinkDB All DBs
Position
1:628686..629420
Genome map
AA seq 244 aa AA seqDB search
MILRAEHLIKKYKQRTVVNDVSFHVEQGEIVGLLGPNGAGKTTSFYMIVGLIKPNDGHVY
LDDLEITQDPMYKRAQRGIGYLAQEASVFRKLSVENNILAVLEIHYPNKEERKAKLEELL
TEFSLHRVRKNRGDLLSGGERRRTEIARALAANPNFILLDEPFAGVDPIAVEEIQTIVAK
LKTRNIGILITDHNVQETLSITDRAYLLTEGKIMLTGTPEEIADNELARKFYLGRHFELR
RKKF
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgattctaagagcagaacatttaatcaaaaaatataaacagcgaacagtagtaaacgat
gtatccttccatgttgaacagggggaaatcgtaggtcttttaggtcctaacggtgccgga
aagacaacttccttttatatgatcgttggattgattaaacctaatgatggacatgtctac
ttagatgacttggaaataacgcaagacccaatgtacaagcgtgcgcagcgcggaatcggt
tatcttgctcaggaagcttcagtttttaggaagctatctgttgaaaacaacatcctagcc
gtattggaaatccattatcccaacaaagaagagcgcaaggctaaactggaagagttattg
actgagttcagtttgcaccgcgtccgcaagaatcgtggcgacctcttgtcgggtggtgaa
cgaaggagaacggagattgccagagcattggccgcaaaccctaactttattctcttagat
gagccttttgcaggtgttgaccccatcgccgtggaagaaatccaaactatcgtagccaaa
ttgaaaaccagaaatatcggaatcctgatcactgaccacaatgttcaagaaactctttcc
atcacagatagagcttacctgttgacggaagggaagatcatgctgaccggtaccccagaa
gaaattgccgacaatgaacttgcacgtaagttctatttgggtagacatttcgaattaaga
cgtaaaaaattctaa

DBGET integrated database retrieval system