KEGG   Sphingobacterium mizutaii: 4412673_01541Help
Entry
4412673_01541     CDS       T05395                                 

Definition
(GenBank) Putative DNA ligase-like protein Rv0938/MT0965
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
smiz  Sphingobacterium mizutaii
Pathway
smiz03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:smiz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    4412673_01541
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:smiz03400]
    4412673_01541
Enzymes [BR:smiz01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     4412673_01541
DNA repair and recombination proteins [BR:smiz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     4412673_01541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: SNV48378
LinkDB All DBs
Position
1:1735701..1738163
Genome map
AA seq 820 aa AA seqDB search
MSNLDQYNKKRDFSQTAEPKAVKGKINATQHHFVVQRHHASRLHYDFRLEIDGALKSWAV
PKGPSLNPKDKRLAVQVEDHPLSYGSFEGSIPEGNYGAGTVSIFDEGKYIPLEVKSDQEF
LKQWKNGNIKFKLEGKVLKGDFALVRMHTGVDKNWLLIKHKDEFSWDKPFDSEKLVSESI
KKEGKDFKKKSDKTETVKKKPLGLDDKSIKPMLAKLSQAIPDGNDWLFEKKFDGFRSLYF
SQNGTKKLISRNGNLLSNKFPSILKDLEGLTRDCILDGEIVIEDKNAIAQFQYLQSGEPI
PKNLNIYYYVFDILYLDNNDLTAYSLLERKEILNLLIKKHKFQHIKLSAEIKSPQKDLLD
YAREQKWEGIIAKRRDDPYGMGQRNGSWLKIKIRNTQEAIICGFTKPEGSRSHFGAIVLG
IKTAGQLKYIGNCGTGFNEELLKSLNKLFKPLVTDVKPFPKTEKIAKEKDVTWLRPELVC
DIYYSEWTRDEHLRHPVFKGIREDKSVNETTKEEPEKEDKIMDKELKFGKKTLKLTNLDK
LYWPTEKISKGDLLDYYEKMGDYILPYLKDKPISMNRFPNGIEAQSFFQKDVDPDKIPAW
LKTTEVFSESTSKTIDYLICNDLPSLLYIVNLGSIEINPWLSTYKNPEKPQYAVLDLDPN
GAEWNDTIDVALTAKEILDKGDIPAFIKTSGSSGLHIFMNVAAKYDYQVVRDFVQFIAEL
IHQVHPETTSLVRDPKKRKGLIYLDYLQNKEGQTIVAPYSVRPKPNATVSTPILWEELNY
DLSIQDFHIFNVYGRVTTIDDPWQELQSSKVDIKKALSKF
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaccttgatcaatataacaaaaaacgagatttttcccagaccgcggaacccaaa
gctgtaaagggaaaaattaatgccacgcaacatcattttgttgttcaaaggcatcatgcc
agtcgacttcattatgattttcgattggaaatcgatggtgcattaaagagctgggcagtt
cctaaaggcccatccctgaatcctaaagacaaaagattggctgttcaagtcgaagaccat
cccctcagttatggatcgtttgaaggcagcattcctgaaggtaattatggcgcaggcacc
gttagtatatttgatgaaggtaagtatatccctttggaagtaaaatccgaccaagaattc
ctaaagcaatggaagaacggtaatattaagttcaagttggaaggcaaggtcctaaaaggt
gattttgctctcgtcaggatgcatactggagtcgataagaattggctattgatcaaacat
aaggatgaattctcatgggataaacctttcgattctgaaaaattggtaagtgaatccatc
aaaaaggaaggtaaggactttaagaaaaaatcagataaaactgaaaccgtaaaaaaaaag
cccctagggctggacgataaaagtataaagcccatgcttgctaaattaagccaagctatt
cctgatggcaatgattggctttttgaaaagaaatttgatggcttccgttcactctatttt
tcccaaaacggcacgaagaaattgatatccagaaatggcaatctgctgagcaataaattt
cccagtatcctcaaagacttggaaggcttaacgagagattgtatcctcgatggcgagatc
gtaattgaagataaaaatgctattgctcaattccaatatctgcagtctggtgaacccatc
cctaaaaacctaaatatctattattatgtgttcgatattctttatctcgataataatgac
ctgacagcctattctttacttgaaagaaaggaaatcctgaatctactaattaaaaaacat
aaattccaacatataaaattgtccgctgaaatcaaatctcctcaaaaggatttattggat
tatgcgagggagcaaaaatgggaaggtattatcgcaaaaagaagagatgatccttacggg
atggggcagagaaacggaagctggctaaaaattaagatccgcaatacacaggaagccatt
atctgtggatttaccaaaccagaaggttcacgatctcattttggagccattgttctaggg
ataaaaacagcaggacaacttaaatatatcggtaattgtggaacgggttttaatgaggaa
ttattgaaatccttaaataaattgttcaaacccttagtgactgatgttaaaccatttcca
aagactgagaaaattgccaaggagaaagatgtcacttggttaagacctgaactggtctgt
gatatatattattcagaatggactagggacgaacatcttcggcaccccgtttttaaaggg
attcgtgaagataaatcggttaatgaaacaacgaaggaagaaccagaaaaggaagataag
attatggataaggaactgaaatttggaaaaaaaacactcaagttaaccaacctggataag
ctatattggccaacagaaaaaattagcaaaggcgaccttttggattattatgaaaagatg
ggcgattatatcttgccttacctgaaagataagcctatttccatgaatagatttccaaat
ggaattgaagcgcaaagcttctttcaaaaagatgtcgatccagataagattcctgcttgg
ctcaagactaccgaagtattttctgaaagtacctccaaaaccattgattatctcatatgc
aatgatttacctagtttactttatattgtcaaccttggttccatcgaaataaacccctgg
ctatcgacttataaaaatcccgaaaaacctcaatatgccgtgcttgacttggatcctaat
ggggcagaatggaatgataccattgatgtggcacttacagcaaaggagatcctggataaa
ggggatatccctgcatttattaaaacatccggatcgagtggtctacatatctttatgaat
gttgcagcaaaatatgattaccaagtagttcgtgattttgttcaatttattgcagagttg
atccatcaggttcatccagaaacgacgagtctggtccgagatccaaaaaaacgaaaagga
ttgatttatctcgattatctacagaacaaagaagggcagaccattgtggcgccttattcg
gtaagaccaaaaccgaatgccacggttagtacacccatcctttgggaagagctcaactat
gacctttcgattcaagatttccatattttcaatgtatatggccgagttactacgattgac
gatccatggcaggaacttcaatcgagtaaggtcgatatcaagaaagccctgtctaaattt
taa

DBGET integrated database retrieval system