KEGG   Streptococcus mutans LJ23 (serotype k): SMULJ23_0107Help
Entry
SMULJ23_0107      CDS       T02086                                 

Gene name
adhC
Definition
(GenBank) putative dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smj  Streptococcus mutans LJ23 (serotype k)
Pathway
smj00010  Glycolysis / Gluconeogenesis
smj00020  Citrate cycle (TCA cycle)
smj00620  Pyruvate metabolism
smj01100  Metabolic pathways
smj01110  Biosynthesis of secondary metabolites
smj01120  Microbial metabolism in diverse environments
smj01130  Biosynthesis of antibiotics
smj01200  Carbon metabolism
Module
smj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMULJ23_0107 (adhC)
   00020 Citrate cycle (TCA cycle)
    SMULJ23_0107 (adhC)
   00620 Pyruvate metabolism
    SMULJ23_0107 (adhC)
Enzymes [BR:smj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SMULJ23_0107 (adhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 PLA2_B
Motif
Other DBs
NCBI-ProteinID: BAL68441
LinkDB All DBs
Position
127634..129001
Genome map
AA seq 455 aa AA seqDB search
MAVEIIMPKLGVDMQEGEIIEWKKQEGDEVKEGEILLEIMSDKTNMEIEAEDSGVLLKIV
KGNGQVVPVTEVIGYIGQAGEVLEIADVPASTVPKENSAAPAEKTKVMSSPTVAAAPQGK
VRATPAARKAARDLGVNLNQVSGTGAKGRVHKEDVESFKAAQPKATPLARKIAIDKGIDL
ASVSGTGFGGKIIKEDILNLFEAAQPVKDVSDPAKEAAALPEGVEVIKMSAMRKAVAKSM
VNSYLTAPTFTLNYDIDMTEMIALRKKLIDPIMEKTGFKVSFTDLIGLAVVKTLMKPEHR
YLNASLINDATEIELHQFVNLGIAVGLDEGLLVPVVHGADKMSLSDFVIASKDVIKKAQT
GKLKATEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIQTPTVVDGEIKIRPIM
ALCLTIDHRLVDGMNGAKFMVDLKKLMENPFTLLI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgaaattattatgcctaaacttggtgttgatatgcaggaaggcgaaatcatc
gagtggaaaaaacaagaaggtgatgaggtcaaagaaggggagatcctccttgagattatg
tctgacaagaccaatatggaaatcgaagctgaggattcaggtgtcctgcttaagattgtt
aaaggaaatggtcaagttgttcctgtaactgaggtcattggttatattggtcaagcaggt
gaagttcttgaaatagctgatgttcctgcaagtacagttcctaaagaaaatagtgcagca
cctgctgaaaaaacaaaagtaatgtcttctccgacagttgcagcagcccctcaaggaaag
gttcgagcaacaccagcagctcgtaaggcggctcgtgatctaggagttaacctgaatcag
gtttcagggacaggcgctaaaggccgtgttcacaaggaagatgttgaaagctttaaagca
gctcagcctaaagcaacaccattagctaggaaaattgctatagataaaggtattgatcta
gccagtgtctcaggaacaggttttggcggcaaaattatcaaggaagatattttaaatctg
tttgaggcagctcagcctgttaaagatgtgtcagatcctgctaaagaagcagctgcctta
ccagagggtgttgaagtcattaagatgtctgccatgcgtaaggcagtggctaaaagcatg
gtcaattcttacctgacagctccaacttttactctcaattatgacattgacatgactgag
atgattgcgttgcgtaaaaagttaattgatcctatcatggaaaaaacaggttttaaagtt
agcttcacagatttgattggtctggcagtcgtaaaaaccttaatgaaaccagaacatcgt
tacctcaatgcttcactcattaatgacgcgactgagattgaacttcatcaatttgttaac
cttggtatcgccgttggacttgatgaaggactgttagtacctgttgttcatggtgcagat
aagatgagcttgtcagattttgttatagcttcaaaggatgtcattaagaaagctcagacc
ggtaaattaaaagccactgaaatgtctggttcaaccttttccattacaaacttggggatg
tttggcactaagactttcaaccccattatcaatcagccaaattcggctattttgggtgta
ggagcaactatccaaacgccaactgttgtggatggtgaaattaagattcgtccaatcatg
gcactgtgcttgaccatcgatcaccgcttggttgatggcatgaacggcgctaagttcatg
gttgatcttaaaaaactgatggaaaatccatttacattattgatttga

DBGET integrated database retrieval system