KEGG   Streptococcus mutans LJ23 (serotype k): SMULJ23_0331Help
Entry
SMULJ23_0331      CDS       T02086                                 

Gene name
yfbQ
Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
smj  Streptococcus mutans LJ23 (serotype k)
Pathway
smj00220  Arginine biosynthesis
smj00250  Alanine, aspartate and glutamate metabolism
smj00290  Valine, leucine and isoleucine biosynthesis
smj01100  Metabolic pathways
smj01110  Biosynthesis of secondary metabolites
smj01130  Biosynthesis of antibiotics
smj01210  2-Oxocarboxylic acid metabolism
smj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SMULJ23_0331 (yfbQ)
   00290 Valine, leucine and isoleucine biosynthesis
    SMULJ23_0331 (yfbQ)
   00220 Arginine biosynthesis
    SMULJ23_0331 (yfbQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smj01007]
    SMULJ23_0331 (yfbQ)
Enzymes [BR:smj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SMULJ23_0331 (yfbQ)
    2.6.1.66  valine---pyruvate transaminase
     SMULJ23_0331 (yfbQ)
Amino acid related enzymes [BR:smj01007]
 Aminotransferase (transaminase)
  Class I
   SMULJ23_0331 (yfbQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: BAL68665
LinkDB All DBs
Position
376372..377589
Genome map
AA seq 405 aa AA seqDB search
MMKEFNKSAKLEHVAYDIRGPVLEEADRMIANGEKILRLNTGNPAAFGLTAPDEVIRDLI
MNARESEGYSDSKGIFSARKAIMQYCQLKNIPDVDVDDIYIGNGVSEMITMSMQGLLDDG
DEVLVPMPDYPLWTAAVSLAGGQAVHYVCDESSNWYPDIDNIKSKITSNTKALVVINPNN
PTGALYPKDVLEDIVEVARQNDLIIFADEIYDRLVMDGGEHVAIASLAPDLFCVSMNGLS
KSHRIAGFRVGWMVLSGPKKHVKDYIEGLNMLSNMRLCSNVLAQQVIQTSLGGVQSIDEL
LLPGGRIYEQRNFIYKAMNEIPGITAVKPQAGLYIFPKIDRNMYRIDDDEQFVLNFLKQE
KILLVHGRGFNWMEPDHFRIVYLPRVEELSKIQEKMTRFLGQYRK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagaatttaataagtctgctaaacttgaacatgtggcctatgatattcgcggt
ccagtattagaagaagccgatcgtatgattgctaatggggagaaaatcttgcgtcttaat
acaggaaatcctgctgcttttggattaacagcacctgatgaggttattcgggatttaatt
atgaatgcgcgtgagagcgaaggttattcagattcgaagggaatcttttcagctcgtaaa
gctattatgcaatattgtcagcttaaaaatattcctgatgttgatgttgatgacatctat
attggcaatggtgtatcggaaatgattactatgtctatgcaaggacttttagatgacggt
gacgaagttttagtccccatgcctgattatccactgtggacggctgctgttagtctggca
ggaggtcaggctgttcattatgtctgtgatgaaagttccaattggtatccagatattgat
aatattaagtctaaaatcacttcaaatacgaaagctcttgtggttatcaatcctaataac
cctacaggggctctttatcccaaagatgtattagaagatatcgttgaagttgctcgtcag
aatgatttaattatttttgctgatgagatttatgatcgtctggtcatggatggtggggaa
catgtggctattgctagtcttgcaccggatcttttttgtgtttctatgaatggtttgtca
aaatcccatcgtattgcaggtttccgtgtaggttggatggttttatctgggcctaaaaaa
catgtcaaagattatattgaaggccttaacatgctttcaaatatgcgcctttgttctaat
gttctggctcaacaagttattcaaacatctttgggcggtgttcagtctattgatgaactt
cttttgccgggtggccgtatttatgaacagcgtaattttatttataaagctatgaatgaa
atccctggaatcacagcggtaaaacctcaggcgggactttatattttcccaaaaattgac
cgtaatatgtatcggattgatgacgatgagcaatttgttctgaattttctcaaacaggaa
aaaatccttcttgttcatggacgcggctttaactggatggaaccagatcatttccgtatt
gtttatttaccgcgtgttgaagagctctctaagattcaagaaaagatgacacgcttccta
gggcaatatcggaaataa

DBGET integrated database retrieval system