KEGG   Streptococcus mutans LJ23 (serotype k): SMULJ23_0536Help
Entry
SMULJ23_0536      CDS       T02086                                 

Gene name
amyA
Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
smj  Streptococcus mutans LJ23 (serotype k)
Pathway
smj00500  Starch and sucrose metabolism
smj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMULJ23_0536 (amyA)
Enzymes [BR:smj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SMULJ23_0536 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: BAL68870
LinkDB All DBs
Position
567417..568877
Genome map
AA seq 486 aa AA seqDB search
MTNETMMQYFEWYLPNDGKHWQHLAEDASHLKNIGISKVWMPPAFKGTGSNDVGYGVYDL
YDLGEFNQNGTVRTKYGSREDYLNAVNALKEQEIMPISDIVLNHKANGDAKERFQVVKVN
PSNRQEKISEPYEIEGWTQFNFPGRQDNYSDFKWHWYHFTGVDYDALHNENGIYMILGDN
KGWASQENIDQENGNYDYLMYDDIDFKHPEVQEHLRDWVAWFLETSGVGGFRLDAIKHID
KTFMAQFIRYIREHLKADLYVFGEYWKDSHFDITDYLHSVDLQFDLIDVMLHMSLFEAGQ
KGSDFDLSTILDDSLMKSHPDFAVTFVDNHDSQRGQALESTVAEWFKPLAYGLILLRQEG
IPCVFYGDYYGISGEFTQESFQTVLDKLLYIRQYHVYGPQEDYFDYANCIGWTCLGDEEH
PDGVAVIMSNGKANCKRMNMGEFNRNKVFVDYLNNCTEEVILDDQGWGDFPVQEASLSAW
VNKDAH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgaaacaatgatgcagtattttgaatggtatttgccaaacgatggtaagcat
tggcagcatttagctgaagatgccagtcatcttaagaatattgggattagcaaagtttgg
atgccaccggcttttaaaggaacgggttccaatgatgttggctatggcgtttatgatctt
tatgatctgggtgaatttaatcaaaatggaactgtcaggaccaagtatggcagcagggaa
gattatctcaatgctgtgaatgctctgaaggagcaggaaatcatgcctatttccgatatt
gtccttaatcacaaggccaatggtgatgccaaagaaagatttcaagtggttaaagtcaat
cccagcaaccgtcaagaaaagatttctgaaccttatgagattgaaggttggacccagttt
aactttccgggtcgacaggataactacagcgatttcaaatggcattggtaccatttcact
ggcgttgattatgacgctcttcataatgaaaatggtatctacatgatcctaggtgataac
aagggttgggccagtcaggaaaatattgatcaggaaaatggtaattatgattacctgatg
tatgatgatattgattttaaacatcctgaagtacaggagcacttgcgagattgggttgct
tggtttttggaaacaagtggtgtcggtggttttcgtttagatgctattaaacatattgat
aagacttttatggcacaatttattcgttatattcgtgagcatcttaaagcagacctttat
gtttttggtgagtactggaaagacagtcatttcgatattaccgattatcttcatagtgtt
gacctgcaatttgacctgattgatgttatgctgcacatgagtctctttgaggctggtcaa
aaaggttctgattttgatttgtcaacgattttagacgatagtctgatgaaaagccatcct
gattttgctgttacttttgttgataatcatgattcccaaagagggcaggctttagagtca
acggttgcagagtggtttaaacctttagcttatggtttgattttgttgcgtcaagagggg
attccttgtgtcttttacggtgattactatggtatttcgggtgaatttactcaggaatct
ttccagactgttttagataaactgctttatatcaggcaataccatgtttatggaccgcaa
gaagattattttgactatgccaattgtattggctggacttgtctgggagatgaagagcac
cctgatggtgtagctgttatcatgtctaatgggaaagccaattgcaaacgtatgaatatg
ggagaatttaatcggaataaggtttttgttgattatcttaataattgtacagaagaagtg
attttagatgatcaaggctggggtgattttccagttcaagaagcttccttgtcagcttgg
gttaataaagatgctcattga

DBGET integrated database retrieval system