KEGG   Streptococcus mutans LJ23 (serotype k): SMULJ23_1242Help
Entry
SMULJ23_1242      CDS       T02086                                 

Gene name
ahpF
Definition
(GenBank) NADH oxidase/alkyl hydroperoxidase reductase peroxide-forming
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
smj  Streptococcus mutans LJ23 (serotype k)
Brite
KEGG Orthology (KO) [BR:smj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SMULJ23_1242 (ahpF)
Enzymes [BR:smj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SMULJ23_1242 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 Thi4 HI0933_like AlaDh_PNT_C FAD_binding_3 DAO NAD_binding_8 Ribosomal_L21p FMO-like K_oxygenase Auto_anti-p27
Motif
Other DBs
NCBI-ProteinID: BAL69576
LinkDB All DBs
Position
complement(1315443..1316975)
Genome map
AA seq 510 aa AA seqDB search
MALDAEIKEQLGQYLQLLESEIVLQAQLKDDANSQKVKEFLQEIVAMSPMISLEEKELPR
TPSFRIAKKGQESGVEFAGLPLGHEFTSFILALLQVSGRPPKVETDIVKRIQAVDEPMHF
ETYVSLTCHNCPDVVQAFNIMSVVNPNISHTMVEGGMFKDEIEAKGIMSVPTVYKDGTEF
TSGRASIEQLLDLIAGPLKEDAFDDKGVFDVLVIGGGPAGNSAAIYAARKGVKTGLLAET
MGGQVMETVGIENMIGTPYVEGPQLMAQVEEHTKSYSVDIMKAPRAKSIQKTDLVEVELD
NGAHLKAKTAVLALGAKWRKINVPGEKEFFNKGVTYCPHCDGPLFTDKKVAVIGGGNSGL
EAAIDLAGLASHVYILEFLPELKADKILQDRAEALDNITILTNVATKEIIGNDHVEGLRY
SDRTTNEEYLLDLEGVFVQIGLVPSTDWLKDSGLALNEKGEIIVAKDGATNIPAIFAAGD
CTDSAYKQIIISMGSGATAALGAFDYLIRN
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcattagacgcagaaatcaaagagcagttaggacagtatcttcaattacttgagtct
gagattgttttacaagctcaattaaaagatgatgctaattctcaaaaagttaaggaattt
ctccaagaaatcgttgcaatgtctcctatgatttctttagaagaaaaggaacttccgcga
acacctagttttcgcatagctaaaaaggggcaagaatctggtgttgaatttgctggctta
ccccttggtcacgaatttacttcgtttatcttggctctgttacaggtttcagggcgtccg
cctaaggtagagactgatattgtcaaacgcattcaagctgttgatgaacctatgcatttt
gaaacctatgttagtttgacttgtcataattgtccagatgttgttcaggctttcaatatc
atgtcagttgttaatcccaacatttcacatacaatggtggaaggtggcatgtttaaagat
gaaattgaagctaagggaattatgtctgtgccaactgtctataaagatggaacagaattt
acctcagggcgtgctagcatagagcaattactagacttgatagcaggtcctcttaaagaa
gatgcttttgatgataaaggtgtttttgatgtccttgttattggtgggggtcctgctggt
aatagcgcggctatttatgctgcaagaaagggagttaaaacaggacttttagctgaaacc
atgggtggtcaagttatggaaaccgtgggtattgaaaatatgatcggtaccccatatgtt
gaaggaccccaattaatggctcaggtggaagagcataccaagtcttattctgttgacatc
atgaaggcaccgcgtgctaagtctattcaaaagacagacttggttgaagttgaacttgat
aatggagctcatttgaaagcaaagacagctgttttggccttaggtgccaagtggcgtaaa
atcaatgtaccaggagaaaaagaattctttaataaaggtgttacttactgtccgcactgt
gatggtcctcttttcacagacaaaaaagtcgctgtcattggcggtggaaactcaggttta
gaagcagctattgatttggctgggttagctagccatgtctatattttagaatttttacct
gagttaaaagctgataagatcttacaagatcgtgcggaagctcttgataatattaccatt
ctaactaatgttgcgactaaagaaattattggtaatgaccacgtagaaggtcttcgttac
agtgatcgtacgaccaatgaagagtacttgcttgatttagaaggtgtttttgttcaaatt
ggattggtacctagtactgactggttaaaggatagtggactagcactcaatgaaaaaggt
gaaatcattgttgctaaagatggcgcaactaatattcctgctatttttgcagctggtgat
tgcacagatagtgcctacaaacaaattatcatttccatgggttctggagctactgcggct
ttaggtgcctttgattatttgattagaaattaa

DBGET integrated database retrieval system