KEGG   Streptococcus mutans LJ23 (serotype k): SMULJ23_1291Help
Entry
SMULJ23_1291      CDS       T02086                                 

Gene name
capP
Definition
(GenBank) putative phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
smj  Streptococcus mutans LJ23 (serotype k)
Pathway
smj00620  Pyruvate metabolism
smj00680  Methane metabolism
smj01100  Metabolic pathways
smj01120  Microbial metabolism in diverse environments
smj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SMULJ23_1291 (capP)
  Energy metabolism
   00680 Methane metabolism
    SMULJ23_1291 (capP)
Enzymes [BR:smj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SMULJ23_1291 (capP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAL69625
LinkDB All DBs
Position
complement(1365447..1368170)
Genome map
AA seq 907 aa AA seqDB search
MTINKLESRNDKEAIAEEITILTKLLDDATKTMVGSASFDKITLFKKLSIEEKHQELERE
IEQLTNEEMVVVSRYFSILPLLINISEDVNLAYEINYQNNNDIDYLGKLSATIELVSSQK
NAQEILENVNVVPVLTAHPTQVQRKTMLDLTNHIHELLRKYRDVKAGSINKQKWYDDMRR
YVELIMQTDIIREKKLKVTNEITNVMEYYNSSLIKGVTKLITEYKHLSQQKGFDLGNAKP
ITMGMWIGGDRDGNPFVTAETLKISALVQNEVILNYYIDKVSDLYRTFSLSTSLSTISNA
VKEMADRSTDVSIYREKEPYRKAFHYIQSRLQETLIYLKNNHLEELESEDSAQILPYQSA
QEFRNDLQLIKDSLLENNGSAFITGDLTELLQAVDVFGFFLASIDMRQDSSVHETCVAEL
LASANIVANYSDLPEEEKIAILLKELTEDPRILSATHVEKSEILQKELAIFKTARKLKDA
LGEDVIKQHIISHTESISDMFELAIMLKEVGLVDTDKARVQIVPLFETIEDLDNSREIMR
QYLNYDIVKKWIAANHNYQEIMLGYSDSNKDGGYLSSGWALYKAQNELTEIGSDNGVKIT
FFHGRGGTVGRGGGPSYEAITSQPFGSIKDRIRLTEQGEVIGNKYGNKDVAYYNLEMLVS
ATLDRMVTRRIVNSDNLVNYRLIMDEIVADSNLIYRDLVFGNKHFYDYFFAASPIREVSS
LNIGSRPAARKTITEISGLRAIPWVFSWSQNRIMFPGWYGVGSAFKHFIDKDEKNLAKLQ
EMYQSWPFFHSLLSNVDMVLSKSNMNIAFEYAKLCQDEETKEVFATILDEWQLTKNVILA
IESHKQLLEDNSYLKASLDYRLPYFNVLNYIQIELIKRQRRGELGENLENLIHITINGVA
TGLRNSG
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
gtgacaatcaacaaactagaaagtagaaatgataaagaagcaattgctgaggagattact
attcttaccaaactactggacgatgctaccaaaacaatggttggcagtgctagctttgat
aagattaccctctttaaaaaattatcaattgaagagaagcatcaagagttagaacgtgaa
attgagcagttaacaaatgaagaaatggtcgttgtttctcgttatttctccattttaccg
cttcttatcaatatttctgaagatgtcaatttagcttatgaaatcaactatcaaaacaat
aatgatattgattatttagggaaattatcagccactattgaacttgtttctagtcaaaaa
aatgctcaagaaattctggaaaatgttaatgttgtccctgttctaacagcgcatccaact
caagtgcagcgaaaaacgatgctggatttaactaatcatattcatgaacttttgcgtaag
taccgtgatgttaaagctggatctattaacaagcaaaaatggtatgacgatatgcgccgt
tatgttgagctcattatgcaaacagatattattcgtgaaaagaaattaaaagtcactaat
gaaattactaatgtcatggaatactataattcctctctgattaagggtgttactaaatta
attacagaatacaagcacttgtctcagcaaaaaggatttgatttaggaaatgctaaacca
attacgatgggaatgtggattggcggtgaccgtgatgggaatcctttcgtcactgctgaa
accctgaaaatatcagctctggtgcaaaatgaagtgattttaaattattatattgacaaa
gtttcagatctttatcgaacattttctctttcaaccagcctttctactattagcaatgca
gttaaagagatggcagatcgttcaacggatgtttcgatttaccgagaaaaagaaccctat
cgtaaggcttttcattatattcaatcaagattgcaagagactcttatttatttaaaaaac
aaccatttagaagagttggagtctgaagatagtgctcaaatccttccttatcaatcagcg
caagagtttagaaatgatttgcaactcatcaaagattctcttttagaaaataacggttct
gcttttattacgggtgatttaacagaattattgcaagcagttgatgtttttggtttcttt
ttagcttctattgatatgcgacaagattccagtgttcacgaaacctgtgtagcagaactg
ttagcttcagccaatattgttgctaactatagcgacttacctgaagaagaaaagattgct
attcttctcaaagaattgactgaagatcctcgaatactgtctgcaacgcatgttgaaaaa
tcggaaatattgcaaaaggaattagctatttttaaaacagctaggaaattgaaggatgct
ctgggagaagatgtgattaaacaacatataatttcacacacagaaagcatttctgatatg
tttgaattagctatcatgctcaaagaagtcggcttggttgatacagataaggcgcgtgtg
caaattgttcctttatttgaaaccattgaggacttggataattctcgcgaaatcatgaga
cagtatctcaattatgatattgttaaaaaatggattgcagccaatcataattatcaggaa
attatgttgggttactcagattctaacaaggatggtggttatttatcgtctggctgggcg
ctctacaaagcacaaaatgaattgacagaaattggttctgataatggtgtcaaaatcacc
tttttccatggacgcggcggtactgttggacgtggtggcggtccatcttatgaggctatt
acatcacagccatttggttccatcaaggatcggattcgtttaacagaacaaggtgaggtt
attggtaataaatatggcaataaggatgttgcatactacaacctggaaatgctggtttca
gcaactcttgatcgcatggtgacaagaaggattgtcaattcagataacttagtcaattat
cgtttaatcatggatgaaattgttgctgacagtaatctcatttatcgtgatttagttttc
ggaaacaaacatttctatgattatttcttcgcagctagtccaattcgcgaagtttcaagt
ttgaatattggttcccgtccagcagctcgtaagacgattacagagatcagcggtttgcgc
gctattccttgggtattctcatggtctcaaaatcgcatcatgtttccaggatggtacggt
gtcggttcagcctttaaacattttatagataaggatgaaaagaatttggctaaattgcag
gaaatgtatcaatcatggcctttcttccattcattgttgtcaaatgttgacatggtttta
tccaaatcaaatatgaatattgcctttgaatatgctaaattatgtcaggatgaagaaaca
aaagaagtctttgcaactattttggatgaatggcaattaaccaaaaatgttattctagca
attgaaagtcacaaacagcttttagaagataatagttatttgaaagctagtcttgattat
cgtttaccttacttcaatgttttaaattatattcaaattgagttaattaaacgtcagcgc
cgtggtgaattaggtgagaatttagagaacctgattcacattactattaatggtgtcgca
actggtttacgaaattcaggttaa

DBGET integrated database retrieval system